MUM1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87147-1-RR (same clone as 87147-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87147-1-RR (MUM1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87147-1-PBS in a different storage buffer formulation.

• 

  Affinity of 87147-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87147-1-RR against Human MUM1 were performed. The affinity constant is 0.974 nM.

MUM1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87147-1-PBS

Clone No.252371H1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

EXPAND1, MUM-1, Mutated melanoma-associated antigen 1, PWWP domain-containing protein MUM1, PWWP3A

---

Product Information

87147-1-PBS targets MUM1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3371

  Product name: Recombinant human MUM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-152 aa of BC008098

  Sequence: MLPDRSRAARDRANQKLVEYIVKAKGAESHLRAILKSRKPSRWLQTFLSSSQYVTCVETYLEDEGQLDLVVKYLQGVYQEVGAKVLQRTNGDRIRFILDVLLPEAIICAISAVDEVDYKTAEEKYIKGPSLSYREKEIFDNQLLEERNRRRR

• Full Name: melanoma associated antigen (mutated) 1
• Calculated Molecular Weight: 18 kDa, 79 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC008098
• Gene Symbol: MUM1
• Gene ID (NCBI): 84939
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q2TAK8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MUM1, also named as EXPAND1, is an architectural component of the chromatin, which in response to DNA damage serves as an accessory factor to promote cell survival. It is a 53BP1-associated DNA damage-responsive factor. MUM1/EXPAND1 is different to another protein IRF4/MUM1.