MYCBP Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MYCBP Polyclonal antibody (12022-1-AP)

• Featured Product
• KD/KO Validated

MYCBP Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 12022-1-AP Copied!

Publications (9)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Synonyms

AMY 1, AMY1, AMY-1, Associate of Myc 1, c-Myc-binding protein

• 

  WB analysis of human heart using 12022-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 12022-1-AP (MYCBP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 12022-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12022-1-AP (MYCBP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human kidney using 12022-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 12022-1-AP (MYCBP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human lung using 12022-1-AP

  human lung tissue were subjected to SDS PAGE followed by western blot with 12022-1-AP (MYCBP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human placenta using 12022-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 12022-1-AP (MYCBP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 12022-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 12022-1-AP (MYCBP antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 12022-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 12022-1-AP (MYCBP antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 12022-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 12022-1-AP (MYCBP antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse colon using 12022-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 12022-1-AP (MYCBP antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 12022-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using MYCBP antibody (12022-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MYCBP in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human heart tissue, A549 cells, human kidney tissue, human lung tissue, human placenta tissue, HEK-293 cells
• Positive IHC detected in: human pancreas cancer tissue, mouse colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12022-1-AP targets MYCBP in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2651

  Product name: Recombinant human MYCBP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-103 aa of BC008686

  Sequence: MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE

• Full Name: c-myc binding protein
• Calculated Molecular Weight: 103 aa, 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC008686
• Gene Symbol: MYCBP
• Gene ID (NCBI): 26292
• RRID: AB_2148722
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99417
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MYC binding protein(MYCBP), encoded by MYCBP gene, binds to N-terminal region of MYC, and then MYC can activate E box-dependent transcription. Upon increasing expression of MYC , MYCBP translocates into the nucleus in the S phase of the cell cycle. MYCBP may involve in spermatogenesis, since it's found to be interacted with AKAP84/149 in the mitochondria in somatic cells and sperm. It highly expressed in heart, placenta, pancreas,skeletal muscle and kidney, but low in lung. This is a rabbit polyclonal antibody raised against full-length MYCBP of human origin.

Publications

What published studies show

MYCBP Polyclonal antibody (Cat# 12022-1-AP) has 9 citations published in journals including Molecular Cell, PNAS, Cell & Molecular Life Sciences, Acta Physiologica, Journal of Cellular and Molecular Medicine, Oncology Letters, eLife, and Journal of Biological Chemistry. Research fields span stress granule regulation in ALS, ubiquitin signaling, Drosophila germline development, ciliary dysfunction and infertility, rhabdomyolysis-induced kidney injury, macrophage polarization, gastric cancer invasion, cilia proteomics, and mitotic chromosome segregation.

Automatically generated from the 9 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; An Interaction Landscape of Ubiquitin Signaling.; Authors - Xiaofei Zhang
human	IF	Mol Cell; Spatiotemporal Proteomic Analysis of Stress Granule Disassembly Using APEX Reveals Regulation by SUMOylation and Links to ALS Pathogenesis.; Authors - Hagai Marmor-Kollet
human	WB,CoIP	Proc Natl Acad Sci U S A; Bourbon and Mycbp function with Otu to promote Sxl protein expression in the Drosophila female germline; Authors - Marianne Mercer
mouse	IF	Cell Mol Life Sci; CFAP65 is essential for C2a projection integrity in axonemes: implications for organ-specific ciliary dysfunction and infertility; Authors - Jinyi Chen
mouse	WB	Acta Physiol (Oxf); A dual role of miR-22 in rhabdomyolysis-induced acute kidney injury.; Authors - S Mathia
mouse	WB	J Cell Mol Med; Mesenchymal stem cell-secreted extracellular vesicles carrying TGF-β1 up-regulate miR-132 and promote mouse M2 macrophage polarization.; Authors - Yongqi Wang