• Featured Product
  • KD/KO Validated

MYCN Polyclonal antibody

MYCN Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10159-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

bHLHe37, MODED, MYCN, N myc, N myc proto oncogene protein, ODED

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman placenta tissue, SKOV-3 cells, C6 cells, mouse brain tissue, SH-SY5Y cells, rat brain tissue
Positive IHC detected inhuman thyroid cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10159-2-AP targets MYCN in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0193

Product name: Recombinant human MYCN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 289-464 aa of BC002712

Sequence: SNTKAVTTFTITVRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLKSVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKVVILKKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC

Predict reactive species
Full Name v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian)
Calculated Molecular Weight 50 kDa
Observed Molecular Weight 65-70 kDa
GenBank Accession NumberBC002712
Gene Symbol MYCN
Gene ID (NCBI) 4613
RRIDAB_2266881
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP04198
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MYCN, also named as BHLHE37 and NMYC, is a transcription factor. It is primarily expressed in normal developing embryos and is thought to be critical in brain and other neural development. It is often amplified in human neuroblastomas. IR34A can suppress MYCN expression, it suggest MYCN has a role in cell growth. The expression of the MCYN is upregulated in a variety of human tumors, most frequently neuroblastoma, where the level of expression appears to increase as the tumor progresses. The calculated molecuar weight of MYCN is 50 kDa, but Phosphorylated MYCN is about 65-70 kDa. MYCN exsits two isoforms and MV of isoform is respectively 65 kDa and 45 kDa. (PMID: 19615087 )

Protocols

Product Specific Protocols
IHC protocol for MYCN antibody 10159-2-APDownload protocol
WB protocol for MYCN antibody 10159-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIHC

Nature

Divergent transcriptional regulation of astrocyte reactivity across disorders.

Authors - Joshua E Burda
humanWB

Elife

Combined ALK and MDM2 inhibition increases antitumor activity and overcomes resistance in human ALK mutant neuroblastoma cell lines and xenograft models.

Authors - Hui Qin Wang
  • KD Validated
humanWB,IHC

Cancers (Basel)

Transcriptomic Analyses of MYCN-Regulated Genes in Anaplastic Wilms' Tumour Cell Lines Reveals Oncogenic Pathways and Potential Therapeutic Vulnerabilities.

Authors - Marianna Szemes
  • KD Validated
mouseIHC

Front Oncol

Downregulation of MYCN through PI3K Inhibition in Mouse Models of Pediatric Neural Cancer.

Authors - Tene Aneka Cage
humanIHC

Cancer

Neuroblastoma of undifferentiated subtype, prognostic significance of prominent nucleolar formation, and MYC/MYCN protein expression: a report from the Children's Oncology Group.

Authors - Larry L Wang
mouseWB,IHC

Front Cell Dev Biol

An E2F5-TFDP1-BRG1 Complex Mediates Transcriptional Activation of MYCN in Hepatocytes.

Authors - Zhiwen Fan

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

CHAO (Verified Customer) (03-31-2022)

Strong bands.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse Heart
FH

Tom (Verified Customer) (08-22-2020)

I saw a specific ~60 kDa band when performing western blots using this MYCN antibody. The band is bigger than molecular weight of MYCN, probably due to post-translational modifications.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse heart
FH

Tom (Verified Customer) (08-22-2020)

I performed immunofluorescence using this antibody. I observed very strong MYCN signal in mouse heart tissue sections. However, I saw cytoplasmic staining in addition to nuclear staining. It is probably due to MYCN's localization to both cytoplasm and nuclei or this antibody has some background staining.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Mouse heart
FH

Jessica (Verified Customer) (10-31-2018)

Strongest band observed was around 60 kDa with some much weaker bands much higher and much lower observable with higher exposures. Ab had affinity for BE2C cell lysate, but did not bind the c-myc expressed in Sy5Y cells on the same blot. I used 2 % skim milk PBST for incubation. As MYCN Abs go this one is pretty good!

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Neuroblastoma cell lines
Loading...
||
New chat

Able

正在加载,请稍候...