Tested Applications
| Positive WB detected in | mouse skeletal muscle tissue, human skeletal muscle tissue, Jurkat cells, A549 cells, rat skeletal muscle tissue |
| Positive IHC detected in | mouse skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
Product Information
21173-1-AP targets MYLK2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15424 Product name: Recombinant human MYLK2 protein Source: e coli.-derived, T-HIS Tag: 6*His Domain: 1-300 aa of BC069627 Sequence: MATENGAVELGIQNPSTDKAPKGPTGERPLAAGKDPGPPDPKKAPDPPTLKKDAKAPASEKGDGTLAQPSTSSQGPKGEGDRGGGPAEGSAGPPAALPQQTATPETSVKKPKAEQGASGSQDPGKPRVGKKAAEGQAAARRGSPAFLHSPSCPAIISSSEKLLAKKPPSEASELTFEGVPMTHSPTDPRPAKAEEGKNILAESQKEVGEKTPGQAGQAKMQGDTSRGIEFQAVPSEKSEVGQALCLTAREEDCFQILDDCPPPPAPFPHRMVELRTGNVSSEFSMNSKEALGGGKFGAVC Predict reactive species |
| Full Name | myosin light chain kinase 2 |
| Calculated Molecular Weight | 596 aa, 65 kDa |
| Observed Molecular Weight | 65 kDa |
| GenBank Accession Number | BC069627 |
| Gene Symbol | MYLK2 |
| Gene ID (NCBI) | 85366 |
| RRID | AB_10733123 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H1R3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MYLK2, also named as MLCK2, belongs to the protein kinase superfamily and CAMK Ser/Thr protein kinase family. MYLK2 catalyze the reaction: ATP + [myosin light-chain] = ADP + [myosin light-chain] phosphate. MYLK2 is implicated in the level of global muscle contraction and cardiac function. MYLK2 phosphorylates a specific serine in the N-terminus of a myosin light chain. Mutation of MYLK2 will cause the cardiomyopathy familial hypertrophic (CMH).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MYLK2 antibody 21173-1-AP | Download protocol |
| WB protocol for MYLK2 antibody 21173-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
iScience SAA1/TLR2 axis directs chemotactic migration of hepatic stellate cells responding to injury. | ||
Exp Ther Med Gelsolin impairs barrier function in pancreatic ductal epithelial cells by actin filament depolymerization in hypertriglyceridemia-induced pancreatitis in vitro. | ||
Microbiol Spectr Berberine Depresses Inflammation and Adjusts Smooth Muscle to Ameliorate Ulcerative Colitis of Cats by Regulating Gut Microbiota |











