Tested Applications
Positive WB detected in | HEK-293 cells, L02 cells |
Positive IP detected in | HEK-293 cells |
Positive IHC detected in | human heart tissue, human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 2 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
Product Information
24309-1-AP targets MYLK4 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag19314 Product name: Recombinant human MYLK4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 4-110 aa of BC132831 Sequence: VKRLEEFNTCYNSNQLEKMAFFQCREEVEKVKCFLEKNSGDQDSRSRHNEAKEVWSNADLTERMPVKSKRTSALAVDIPAPPAPFDHRIVTAKQGAVNSFYTVSKTE Predict reactive species |
Full Name | myosin light chain kinase family, member 4 |
Calculated Molecular Weight | 388 aa, 45 kDa |
Observed Molecular Weight | 45 kDa |
GenBank Accession Number | BC132831 |
Gene Symbol | MYLK4 |
Gene ID (NCBI) | 340156 |
RRID | AB_2877632 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q86YV6 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MYLK4(Myosin light chain kinase family member 4) is also named as SGK085 and belongs to the CAMK Ser/Thr protein kinase family. MLCKs are activated by Ca2+-calmodulin complexes and require Mg2+ or Ca2+ as a co-factor. It has 2 isoforms produced by alternative splicing.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MYLK4 antibody 24309-1-AP | Download protocol |
IHC protocol for MYLK4 antibody 24309-1-AP | Download protocol |
IP protocol for MYLK4 antibody 24309-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Proc Natl Acad Sci U S A Cardiac myosin light chain is phosphorylated by Ca2+/calmodulin-dependent and -independent kinase activities. | ||
J Exp Clin Cancer Res MYLK4 promotes tumor progression through the activation of epidermal growth factor receptor signaling in osteosarcoma.
| ||
bioRxiv GATA1-defective immune-megakaryocytes as possible drivers of idiopathic pulmonary fibrosis |