MYLK4 Polyclonal antibody

• 

  WB analysis using 24309-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 24309-1-AP (MYLK4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 24309-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 24309-1-AP (MYLK4 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of L02 using 24309-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 24309-1-AP (MYLK4 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293 using 24309-1-AP

  IP result of anti-MYLK4 (IP:24309-1-AP, 4ug; Detection:24309-1-AP 1:500) with HEK-293 cells lysate 3600ug.

• 

  IHC staining of human heart using 24309-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 24309-1-AP (MYLK4 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human heart using 24309-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 24309-1-AP (MYLK4 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human tonsillitis using 24309-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 24309-1-AP (MYLK4 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human tonsillitis using 24309-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 24309-1-AP (MYLK4 Antibody) at dilution of 1:50 (under 40x lens).

• Featured Product
• KD/KO Validated

MYLK4 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 24309-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, IP, ELISA

Synonyms

MLCK4, MYLK4, SgK085, Sugen kinase 85

---

Tested Applications

• Positive WB detected in: HEK-293 cells, L02 cells
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human heart tissue, human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:100-1:400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

24309-1-AP targets MYLK4 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19314

  Product name: Recombinant human MYLK4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 4-110 aa of BC132831

  Sequence: VKRLEEFNTCYNSNQLEKMAFFQCREEVEKVKCFLEKNSGDQDSRSRHNEAKEVWSNADLTERMPVKSKRTSALAVDIPAPPAPFDHRIVTAKQGAVNSFYTVSKTE

• Full Name: myosin light chain kinase family, member 4
• Calculated Molecular Weight: 388 aa, 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC132831
• Gene Symbol: MYLK4
• Gene ID (NCBI): 340156
• RRID: AB_2877632
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86YV6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MYLK4(Myosin light chain kinase family member 4) is also named as SGK085 and belongs to the CAMK Ser/Thr protein kinase family. MLCKs are activated by Ca2+-calmodulin complexes and require Mg2+ or Ca2+ as a co-factor. It has 2 isoforms produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB,IHC	Proc Natl Acad Sci U S A; Cardiac myosin light chain is phosphorylated by Ca2+/calmodulin-dependent and -independent kinase activities.; Authors - Audrey N Chang
human	WB	J Exp Clin Cancer Res; MYLK4 promotes tumor progression through the activation of epidermal growth factor receptor signaling in osteosarcoma.; Authors - Mengkai Yang ; KD Validated
	IF	bioRxiv; GATA1-defective immune-megakaryocytes as possible drivers of idiopathic pulmonary fibrosis; Authors - Francesca Gobbo