Tested Applications
| Positive WB detected in | Jurkat cells, rat spleen tissue |
| Positive IHC detected in | mouse spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28841-1-AP targets MYO1F in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29899 Product name: Recombinant human MYO1F protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 198-276 aa of BC028071 Sequence: VMQNENERNFHIYYQLLEGASQEQRQNLGLMTPDYYYYLNQSDTYQVDGTDDRSDFGETLSAMQVIGIPPSIQQLVLQL Predict reactive species |
| Full Name | myosin IF |
| Calculated Molecular Weight | 1098 aa, 125 kDa |
| Observed Molecular Weight | 115-125 kDa |
| GenBank Accession Number | BC028071 |
| Gene Symbol | MYO1F |
| Gene ID (NCBI) | 4542 |
| RRID | AB_3669671 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00160 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Myosin family members are proteins that hydrolyze ATP to generate force or directional movement along actin filaments and are implicated in the rearrangement of the cytoskeleton in several cell types. Myosin 1F (MYO1F), a long tailed class I myosin, is highly expressed in natural killer (NK) cells, macrophages, dendritic cells, and neutrophils. MYO1F plays a critical role in the mediating of signaling molecules "trafficking from membrane to cytoplasm," and this process is essential for the antifungal signaling pathway activation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MYO1F antibody 28841-1-AP | Download protocol |
| IHC protocol for MYO1F antibody 28841-1-AP | Download protocol |
| WB protocol for MYO1F antibody 28841-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







