• Featured Product
  • KD/KO Validated

MYO6 Polyclonal antibody

MYO6 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA
Cat No. 26778-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IF-P, IP, ELISA

Unconventional myosin-6, Unconventional myosin 6, myosin VI, KIAA0389, DFNB37

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, mouse small intestine tissue, DU 145 cells, LNCaP cells, MCF-7 cells
Positive IP detected inPC-3 cells
Positive IHC detected inhuman prostate cancer tissue, human small intestine tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse small intestine tissue
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26778-1-AP targets MYO6 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag24906

Product name: Recombinant human MYO6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-145 aa of BC146764

Sequence: MEDGKPVWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVEDNCSLMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSEAIKSYQGKSLGTRPPHVFAIADKAFRDMKVLKMSQ

Predict reactive species
Full Name myosin VI
Calculated Molecular Weight 1285 aa, 149 kDa
Observed Molecular Weight 145-150 kDa
GenBank Accession NumberBC146764
Gene Symbol MYO6
Gene ID (NCBI) 4646
RRIDAB_2880631
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UM54
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MYO6, an actin-based motor protein, is the only myosin known to move toward the minus end of actin filaments. MYO6 is highly expressed in the inner and outer hair cells of the ear, retina, and polarized epithelial cells such as kidney proximal tubule cells and intestinal enterocytes. And it participates in a wide range of biological processes within cells, including clathrin-mediated endocytosis, vesicular membrane traffic, polarized secretion, and autophagy (PMID: 23620821; PMID: 28591580). Previous studies showed that MYO6 is upregulated in various types of cancer, and it has been widely reported to contribute to tumor cell migration and metastasis. Some articles indicate that MYO6 is associated with prostate cancer, lung cancer, human colorectal cancer and gastric cancer (PMID: 29022908).

Protocols

Product Specific Protocols
IF protocol for MYO6 antibody 26778-1-APDownload protocol
IHC protocol for MYO6 antibody 26778-1-APDownload protocol
IP protocol for MYO6 antibody 26778-1-APDownload protocol
WB protocol for MYO6 antibody 26778-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nat Commun

Structure of Myosin VI/Tom1 complex reveals a cargo recognition mode of Myosin VI for tethering.

Authors - Shichen Hu
ratWB,IF

Front Cardiovasc Med

Herb pair of Astragali Radix-Descurainiae Semen attenuate heart failure through the myosin VI-Tom1 complex mediated autophagy

Authors - Mengyue Wang
WB

Authors -
humanWB

Int J Mol Sci

The Suppression of the Epithelial to Mesenchymal Transition in Prostate Cancer through the Targeting of MYO6 Using MiR-145-5p

Authors - Lee Armstrong
humanIF

Cancer Manag Res

The Actin Motor Protein Myosin 6 Contributes to Cell Migration and Expression of GIPC1 and Septins in Breast Cancer Cells

Authors - Magdalena Izdebska
IHC

Cell Commun Signal

MYO6 contributes to tumor progression and enzalutamide resistance in castration-resistant prostate cancer by activating the focal adhesion signaling pathway

Authors - Shengfeng Zheng

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Wojciech (Verified Customer) (04-20-2023)

We used this antibody to assess protein levels in human T cells. We got a good signal with 1:1000 dilution with observed molecular weight at ~150kDa.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: T cells
FH

Sara (Verified Customer) (10-25-2020)

B cells (mouse) in RIPA buffer. 10 µg of protein per lane were loaded on a 10% PAGE-SDS gel. Transfer is not optimised for high MW proteins, so I could get a better blot. Two bands are detected, one of 150 kDa and one > 200 kDa.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse B cells from spleen
MYO6 Antibody Western Blot validation (1:1000 dilution) in Mouse B cells from spleen (Cat no:26778-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...