Tested Applications
Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
26869-1-AP targets MYO9A in IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24866 Product name: Recombinant human MYO9A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 415-470 aa of BC140869 Sequence: TRRQIFSLLSAILHLGNICYKKKTYRDDSIDICNPEVLPIVSELLEVKEEMLFEAL Predict reactive species |
Full Name | myosin IXA |
GenBank Accession Number | BC140869 |
Gene Symbol | MYO9A |
Gene ID (NCBI) | 4649 |
RRID | AB_2918112 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | B2RTY4 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for MYO9A antibody 26869-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |