Mammaglobin A Polyclonal antibody

• 

  IHC staining of human breast cancer using 25645-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 25645-1-AP (Mammaglobin A antibody at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human breast cancer using 25645-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 25645-1-AP (Mammaglobin A antibody at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human breast using 25645-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast tissue slide using 25645-1-AP (Mammaglobin A antibody at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human breast using 25645-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast tissue slide using 25645-1-AP (Mammaglobin A antibody at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human breast using 25645-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast tissue slide using 25645-1-AP (Mammaglobin A antibody at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human breast using 25645-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast tissue slide using 25645-1-AP (Mammaglobin A antibody at dilution of 1:50 (under 40x lens).

Mammaglobin A Polyclonal Antibody for IHC, ELISA

Cat No. 25645-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

hMAM, Mammaglobin 1, Mammaglobin A, MGB1, SCGB2A2, UGB2

---

Tested Applications

• Positive IHC detected in: human breast cancer tissue, human breast tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25645-1-AP targets Mammaglobin A in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22324

  Product name: Recombinant human SCGB2A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-93 aa of BC128252

  Sequence: MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF

• Full Name: secretoglobin, family 2A, member 2
• Calculated Molecular Weight: 93 aa, 10 kDa
• GenBank Accession Number: BC128252
• Gene Symbol: Mammaglobin A
• Gene ID (NCBI): 4250
• RRID: AB_2880174
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13296
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SCGB2A2, also known as mammaglobin A, is a member of the secretoglobin superfamily. It is a breast cancer-associated antigen almost exclusively over-expressed in primary and metastatic human breast cancers, making it a specific molecular marker and a potential therapeutic target for breast cancer. SCGB2A2 is a 93-amino acid protein with a calculated molecular weight of 10.5 kDa.