Tested Applications
Positive IHC detected in | human breast cancer tissue, human breast tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
25645-1-AP targets Mammaglobin A in IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22324 Product name: Recombinant human SCGB2A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-93 aa of BC128252 Sequence: MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF Predict reactive species |
Full Name | secretoglobin, family 2A, member 2 |
Calculated Molecular Weight | 93 aa, 10 kDa |
GenBank Accession Number | BC128252 |
Gene Symbol | Mammaglobin A |
Gene ID (NCBI) | 4250 |
RRID | AB_2880174 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q13296 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SCGB2A2, also known as mammaglobin A, is a member of the secretoglobin superfamily. It is a breast cancer-associated antigen almost exclusively over-expressed in primary and metastatic human breast cancers, making it a specific molecular marker and a potential therapeutic target for breast cancer. SCGB2A2 is a 93-amino acid protein with a calculated molecular weight of 10.5 kDa.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for Mammaglobin A antibody 25645-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |