Tested Applications
| Positive IHC detected in | human ovary tumor tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21211-1-AP targets Mammaglobin B in IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15609 Product name: Recombinant human Mammaglobin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 50-95 aa of BC062218 Sequence: IDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN Predict reactive species |
| Full Name | secretoglobin, family 2A, member 1 |
| Calculated Molecular Weight | 95 aa, 11 kDa |
| GenBank Accession Number | BC062218 |
| Gene Symbol | Mammaglobin B |
| Gene ID (NCBI) | 4246 |
| RRID | AB_3085644 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75556 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Mammaglobin B, also referred to as secretoglobin family 2A member 1 (SCGB2A1), is a member of the uteroglobin superfamily. SCGB2A1 has been identified as a candidate biomarker for the detection of lymph node micrometastases in breast cancer and abdominal cancer types. SCGB2A1 has been considered as a promising diagnostic marker for occult tumor cells in effusions of several malignancies and as a potential immunotherapeutic target in ovarian cancer.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Mammaglobin B antibody 21211-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







