Product Information
83157-2-PBS targets MCP-1/CCL2 in Indirect ELISA applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg0427 Product name: Recombinant Mouse MCP-1/CCL2 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 24-148 aa of NM-011333 Sequence: QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN Predict reactive species |
| Full Name | chemokine (C-C motif) ligand 2 |
| GenBank Accession Number | NM-011333 |
| Gene Symbol | MCP-1/CCL2 |
| Gene ID (NCBI) | 20296 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P10148 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

