Product Information
83157-2-PBS targets MCP-1/CCL2 in Indirect ELISA applications and shows reactivity with mouse samples.
Tested Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Eg0427 Product name: Recombinant Mouse MCP-1/CCL2 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 24-148 aa of NM-011333 Sequence: QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN Predict reactive species |
Full Name | chemokine (C-C motif) ligand 2 |
GenBank Accession Number | NM-011333 |
Gene Symbol | MCP-1/CCL2 |
Gene ID (NCBI) | 20296 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P10148 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |