Product Information
98028-1-PBS targets MCP-1/CCL2 in FC (Intra) applications and shows reactivity with mouse samples.
Tested Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Eg0427 Product name: Recombinant Mouse MCP-1/CCL2 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 24-148 aa of NM-011333 Sequence: QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN Predict reactive species |
Full Name | chemokine (C-C motif) ligand 2 |
GenBank Accession Number | NM-011333 |
Gene Symbol | MCP-1/CCL2 |
Gene ID (NCBI) | 20296 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purfication |
UNIPROT ID | P10148 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
Monocyte chemotactic protein 1 (MCP-1), also known as CCL2, is chemotactic for monocyte/macrophage, B cell, and T cell, and belongs to the CC subfamily of chemokines. Chemokines are a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The human ortholog has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis, and atherosclerosis.