Anti-Mouse MCP-1/CCL2 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of RAW 264.7 using 98028-1-RR (same clone as 98028-1-PBS)

  1x10^6 untreated or LPS and Brefeldin A treated RAW 264.7 cells were intracellularly stained with 0.25 ug Anti-Mouse MCP-1/CCL2 Rabbit RecAb (98028-1-RR, Clone: 230483A9) and PE-conjugated Goat Anti-Rabbit IgG. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 98028-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 98028-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98028-1 -RR against Mouse Mcp1 were performed. The affinity constant is below 1 nM.

MCP-1/CCL2 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98028-1-PBS

Clone No.230483A9

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

Ccl2, MCP1, MCP-1, 230483A9, C-C motif chemokine 2

---

Product Information

98028-1-PBS targets MCP-1/CCL2 in FC (Intra) applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0427

  Product name: Recombinant Mouse MCP-1/CCL2 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 24-148 aa of NM-011333

  Sequence: QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN

• Full Name: chemokine (C-C motif) ligand 2
• GenBank Accession Number: NM-011333
• Gene Symbol: MCP-1/CCL2
• Gene ID (NCBI): 20296
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P10148
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Monocyte chemotactic protein 1 (MCP-1), also known as CCL2, is chemotactic for monocyte/macrophage, B cell, and T cell, and belongs to the CC subfamily of chemokines. Chemokines are a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The human ortholog has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis, and atherosclerosis.