Midkine Polyclonal antibody

• 

  WB analysis using 28546-1-AP

  Mouse embryo tissues were subjected to SDS PAGE followed by western blot with 28546-1-AP (Midkine antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human pancreas cancer using 28546-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 28546-1-AP (Midkine antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 28546-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 28546-1-AP (Midkine antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 28546-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 28546-1-AP (Midkine antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 28546-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 28546-1-AP (Midkine antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 28546-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 28546-1-AP (Midkine antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 28546-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 28546-1-AP (Midkine antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Midkine Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28546-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse and More (1)

Applications

WB, IHC, ELISA

Synonyms

ARAP, FLJ27379, MDK, Midkine, MK, MK1, NEGF2

---

Tested Applications

• Positive WB detected in: mouse embryo tissue
• Positive IHC detected in: human pancreas cancer tissue, human stomach cancer tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IHC: See 1 publications below

Product Information

28546-1-AP targets Midkine in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29185

  Product name: Recombinant human MDK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 79-143 aa of BC011704

  Sequence: EFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

• Full Name: midkine (neurite growth-promoting factor 2)
• Calculated Molecular Weight: 16 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC011704
• Gene Symbol: Midkine
• Gene ID (NCBI): 4192
• RRID: AB_2881168
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P21741
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	EBioMedicine; Spatial and single-cell colocalisation analysis reveals MDK-mediated immunosuppressive environment with regulatory T cells in colorectal carcinogenesis; Authors - Masahiro Hashimoto
human	WB,IHC	Mol Ther Oncol; Comprehensive machine learning-based integration develops a novel prognostic model for glioblastoma; Authors - Qian Jiang
	WB	ACS Nano; Precise Photodynamic Therapy by Midkine Nanobody-Engineered Nanoparticles Remodels the Microenvironment of Pancreatic Ductal Adenocarcinoma and Potentiates the Immunotherapy; Authors - Chengming Qu