Tested Applications
Positive WB detected in | mouse embryo tissue |
Positive IHC detected in | human pancreas cancer tissue, human stomach cancer tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 3 publications below |
IHC | See 1 publications below |
Product Information
28546-1-AP targets Midkine in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples.
Tested Reactivity | Human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag29185 Product name: Recombinant human MDK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 79-143 aa of BC011704 Sequence: EFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD Predict reactive species |
Full Name | midkine (neurite growth-promoting factor 2) |
Calculated Molecular Weight | 16 kDa |
Observed Molecular Weight | 16 kDa |
GenBank Accession Number | BC011704 |
Gene Symbol | Midkine |
Gene ID (NCBI) | 4192 |
RRID | AB_2881168 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P21741 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Midkine antibody 28546-1-AP | Download protocol |
IHC protocol for Midkine antibody 28546-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
EBioMedicine Spatial and single-cell colocalisation analysis reveals MDK-mediated immunosuppressive environment with regulatory T cells in colorectal carcinogenesis | ||
Mol Ther Oncol Comprehensive machine learning-based integration develops a novel prognostic model for glioblastoma | ||
ACS Nano Precise Photodynamic Therapy by Midkine Nanobody-Engineered Nanoparticles Remodels the Microenvironment of Pancreatic Ductal Adenocarcinoma and Potentiates the Immunotherapy |