Tested Applications
| Positive WB detected in | mouse embryo tissue |
| Positive IHC detected in | human pancreas cancer tissue, human stomach cancer tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
| IHC | See 1 publications below |
Product Information
28546-1-AP targets Midkine in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples.
| Tested Reactivity | Human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29185 Product name: Recombinant human MDK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 79-143 aa of BC011704 Sequence: EFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD Predict reactive species |
| Full Name | midkine (neurite growth-promoting factor 2) |
| Calculated Molecular Weight | 16 kDa |
| Observed Molecular Weight | 16 kDa |
| GenBank Accession Number | BC011704 |
| Gene Symbol | Midkine |
| Gene ID (NCBI) | 4192 |
| RRID | AB_2881168 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P21741 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Midkine antibody 28546-1-AP | Download protocol |
| WB protocol for Midkine antibody 28546-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Ther Oncol Comprehensive machine learning-based integration develops a novel prognostic model for glioblastoma | ||
ACS Nano Precise Photodynamic Therapy by Midkine Nanobody-Engineered Nanoparticles Remodels the Microenvironment of Pancreatic Ductal Adenocarcinoma and Potentiates the Immunotherapy | ||
EBioMedicine Spatial and single-cell colocalisation analysis reveals MDK-mediated immunosuppressive environment with regulatory T cells in colorectal carcinogenesis |













