CoraLite® Plus 488-conjugated Midkine Recombinant monoclonal antibody

Midkine Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-84815
Clone No.241880H1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

MDK, 241880H1, Amphiregulin-associated protein, Neurite outgrowth-promoting factor 2, Neurite outgrowth-promoting protein

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84815 targets Midkine in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag24547

Product name: Recombinant human MDK protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-143 aa of BC011704

Sequence: MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Predict reactive species
Full Name midkine (neurite growth-promoting factor 2)
Calculated Molecular Weight 16 kDa
GenBank Accession NumberBC011704
Gene Symbol Midkine
Gene ID (NCBI) 4192
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP21741
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Midkine is a heparin-binding growth factor identified over 20 years ago and enhances the survival, migration and many other activities of target cells. Midkine is rich in both basic amino acids and cysteine, and is not related to most other growth factors/cytokines. It is strongly expressed during embryonic periods, especially at the midgestation stage, and plays important roles in development, especially in neurogenesis. Midkine expression in adult tissue is generally weak or undetectable, and it is induced upon injury and exerts many activities related to tissue repair. The biological activities of midkine in malignant tumors include proliferation, angiogenesis, invasion and metastasis. Various cancers express significantly higher levels of the midkine protein in early stage tumor tissues than in adjacent normal tissue.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Midkine antibody CL488-84815Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...