Tested Applications
| Positive IHC detected in | mouse embryo tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF/ICC detected in | HeLa cells | 
| Positive FC (Intra) detected in | HeLa cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 | 
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
84815-1-RR targets Midkine in IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human | 
| Host / Isotype | Rabbit / IgG | 
| Class | Recombinant | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag24547 Product name: Recombinant human MDK protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-143 aa of BC011704 Sequence: MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD Predict reactive species | 
                                    
| Full Name | midkine (neurite growth-promoting factor 2) | 
| Calculated Molecular Weight | 16 kDa | 
| GenBank Accession Number | BC011704 | 
| Gene Symbol | Midkine | 
| Gene ID (NCBI) | 4192 | 
| RRID | AB_3672139 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein A purification | 
| UNIPROT ID | P21741 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
Midkine is a heparin-binding growth factor identified over 20 years ago and enhances the survival, migration and many other activities of target cells. Midkine is rich in both basic amino acids and cysteine, and is not related to most other growth factors/cytokines. It is strongly expressed during embryonic periods, especially at the midgestation stage, and plays important roles in development, especially in neurogenesis. Midkine expression in adult tissue is generally weak or undetectable, and it is induced upon injury and exerts many activities related to tissue repair. The biological activities of midkine in malignant tumors include proliferation, angiogenesis, invasion and metastasis. Various cancers express significantly higher levels of the midkine protein in early stage tumor tissues than in adjacent normal tissue.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Midkine antibody 84815-1-RR | Download protocol | 
| IF protocol for Midkine antibody 84815-1-RR | Download protocol | 
| IHC protocol for Midkine antibody 84815-1-RR | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 









