MultiPro® 5CFLX Anti-Human LEF1 (Polyclonal)

LEF1 Polyclonal Antibody for Single Cell (Intra)
Cat No. G14972-1-5C

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

Single Cell (Intra)

LEF 1, LEF1, TCF1 alpha, TCF1ALPHA

Formulation:  PBS, Azide
PBS, Azide
Conjugate:  5CFLX
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive Single Cell (Intra) detected in10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product.

Recommended dilution

ApplicationDilution
SINGLE CELL (INTRA)<0.5ug/test
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Product Information

G14972-1-5C targets LEF1 in Single Cell (Intra) applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Rabbit / IgG
Class Oligo Conjugate
Type Polyclonal
Immunogen

CatNo: Ag6882

Product name: Recombinant human LEF1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-399 aa of BC050632

Sequence: MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI

Predict reactive species
Full Name MultiPro® 5CFLX Anti-Human LEF1 (Polyclonal)
Calculated Molecular Weight 37 kDa
GenBank Accession NumberBC050632
Gene Symbol LEF1
Gene ID (NCBI) 51176
ENSEMBL Gene IDENSG00000138795
RRIDAB_3673889
Conjugate 5CFLX
Full Oligo SequenceCGGAGATGTGTATAAGAGACAGCATACAGGCTGACAACCCATATAAGAAA
Barcode SequenceCATACAGGCTGACAA
FormLiquid
UNIPROT IDQ9UJU2
Storage Buffer PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3.
Storage Conditions2-8°C Stable for one year after shipment.

Background Information

Lymphoid enhancer-binding factor 1(LEF1) belongs to a family of regulatory protein share homology with high mobility group protein-1, and it's a nuclear protein exprssed in pre-B and T cells. LEF1 has a role in the Wnt signaling pathway and hair cell differentiation and follicle morphogenesis. Together with CTNNB1 and EP300, LEF1 activates transcription of target genes. Isoform 5 transcriptionally activates the fibronectin promoter, binds to and represses transcription from the E-cadherin promoter in a CTNNB1-independent manner, and is involved in reducing cellular aggregation and increasing cell migration of pancreatic cancer cells. Isoform 1 transcriptionally activates MYC and CCND1 expression and enhances proliferation of pancreatic tumor cells. MECs can give rise to seven cell types of the SAE and SMGs following severe airway injury. MECs progressively adopted a basal cell phenotype on the SAE and established lasting progenitors capable of further regeneration following reinjury. MECs activate Wnt-regulated transcription factors (Lef-1/TCF7) following injury and Lef-1 induction in cultured MECs promoted transition to a basal cell phenotype. Surprisingly, dose-dependent MEC conditional activation of Lef-1in vivopromoted self-limited airway regeneration in the absence of injury. Thus, modulating the Lef-1 transcriptional program in MEC-derived progenitors may have regenerative medicine applications for lung diseases. (https://doi.org/10.1016/j.stem.2018.03.017) The phosphorylation may affects LEF1 protein's theoretical molecular weight when tested.40-70 kD bands have also been reported (PMID: 22261717; 17063141 ).

Protocols

MultiPro™ Cell Surface and Intracellular Staining ProtocolDownload protocol
10x Genomics Cell Surface Protein Only Staining ProtocolDownload protocol
Loading...
||
New chat Able
正在加载,请稍候...