Myogenin Polyclonal antibody, PBS Only

• 

  WB analysis using 26762-1-AP (same clone as 26762-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26762-1-AP (Myogenin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26762-1-PBS in a different storage buffer formulation.

Myogenin Polyclonal Antibody for WB, Indirect ELISA

Cat No. 26762-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

MYOG, Myf-4, MYF4, Myf 4, Class C basic helix-loop-helix protein 3

---

Product Information

26762-1-PBS targets Myogenin in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25081

  Product name: Recombinant human Myogenin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 138-224 aa of BC053899

  Sequence: SLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN

• Full Name: myogenin (myogenic factor 4)
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC053899
• Gene Symbol: Myogenin
• Gene ID (NCBI): 4656
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P15173
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MYOG (encoded Myogenin protein) is a muscle-specific transcription factor that belongs to a family of basic helix-loop-helix transcription factors. It plays a role in muscle differentiation, cell cycle exit, and muscle atrophy(PMID: 30315160). Diseases associated with MYOG include Embryonal Rhabdomyosarcoma and Gallbladder Sarcoma.