Tested Applications
| Positive WB detected in | mouse heart tissue, mouse skeletal muscle tissue, rat heart tissue, rat skeletal muscle tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26762-1-AP targets Myogenin in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25081 Product name: Recombinant human Myogenin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 138-224 aa of BC053899 Sequence: SLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN Predict reactive species |
| Full Name | myogenin (myogenic factor 4) |
| Calculated Molecular Weight | 25 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC053899 |
| Gene Symbol | Myogenin |
| Gene ID (NCBI) | 4656 |
| RRID | AB_3669566 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P15173 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MYOG (encoded Myogenin protein) is a muscle-specific transcription factor that belongs to a family of basic helix-loop-helix transcription factors. It plays a role in muscle differentiation, cell cycle exit, and muscle atrophy(PMID: 30315160). Diseases associated with MYOG include Embryonal Rhabdomyosarcoma and Gallbladder Sarcoma.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for Myogenin antibody 26762-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Myogenin Polyclonal antibody (Cat# 26762-1-AP) has 15 total citations. These appear in journals including Redox Biology, Food Chemistry X, Food Research International, Regenerative Biomaterials, Free Radical Biology and Medicine, Acta Physiologica, International Journal of Molecular Sciences, Scientific Reports, FASEB Journal, Current Issues in Molecular Biology, BMC Genomics, Journal of Diabetes Complications, Sports Medicine and Health Science, Biochemical and Biophysical Research Communications, and International Urogynecology Journal. The research fields center on skeletal muscle biology, including myogenesis, muscle atrophy, sarcopenia, regeneration, and related signaling pathways.
| Species | Application | Title |
|---|---|---|
Redox Biol iPSC-derived cardiomyocytes and engineered heart tissues reveal suppressed JAK2/STAT3 signaling in LMNA-related emery-dreifuss muscular dystrophy | ||
Food Chem X Astaxanthin and naringin synergistically promote proliferation and myogenic differentiation of piscine satellite cells via mTOR signaling. | ||
Food Res Int Lentinan mitigates age-related sarcopenia through the promotion of mitochondrial biogenesis. | ||
Regen Biomater An injectable self-healing curcumin-sustained-release hydrogel for lower limb ischemia via autophagy inhibition by Atp6v0d2 downregulation. | ||
Free Radic Biol Med USP47 stabilizes HDAC2 to ameliorate cigarette smoke-induced skeletal muscle atrophy by suppressing CYP1A1/ROS-mediated autophagy. | ||
Acta Physiol (Oxf) Progranulin Regulates Protein Synthesis in Myocytes Through an Ephrin Type A Receptor 2-Dependent Pathway. |
Reviews
What customers say
The product has one verified review rated 5 out of 5 stars. The reviewer used it for Western Blot at a 1:1000 dilution on mouse myoblast C2C12 cells differentiated for 5 days in DMEM supplemented with 2% horse serum and 1% penicillin-streptomycin. The reviewer reported satisfactory performance with clear band detection under these conditions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Kazuaki (Verified Customer) (01-28-2025) | C2C12 cells differentiated for 5 days by using DMEM with 2%HS and 1%PS
 |
