Myogenin Polyclonal antibody

• 

  WB analysis using 26762-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26762-1-AP (Myogenin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

Myogenin Polyclonal Antibody for WB, ELISA

Cat No. 26762-1-AP

Publications(4)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, ELISA

Synonyms

MYOG, Myf-4, MYF4, Myf 4, Class C basic helix-loop-helix protein 3

---

Tested Applications

• Positive WB detected in: mouse heart tissue, mouse skeletal muscle tissue, rat heart tissue, rat skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IF: See 1 publications below

Product Information

26762-1-AP targets Myogenin in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25081

  Product name: Recombinant human Myogenin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 138-224 aa of BC053899

  Sequence: SLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN

• Full Name: myogenin (myogenic factor 4)
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC053899
• Gene Symbol: Myogenin
• Gene ID (NCBI): 4656
• RRID: AB_3669566
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P15173
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MYOG (encoded Myogenin protein) is a muscle-specific transcription factor that belongs to a family of basic helix-loop-helix transcription factors. It plays a role in muscle differentiation, cell cycle exit, and muscle atrophy(PMID: 30315160). Diseases associated with MYOG include Embryonal Rhabdomyosarcoma and Gallbladder Sarcoma.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Int Urogynecol J; Mechanical Stress-Oxidative Stress Axis: Biological Basis in the Vaginal Wall and Pelvic Floor Muscles of Rats with Simulated Birth Injury; Authors - Qing Wang
rat	WB	J Diabetes Complications; Liraglutide improves senescence and ameliorating diabetic sarcopenia via the YAP-TAZ pathway; Authors - Qian Xu
human	IF	Redox Biol; iPSC-derived cardiomyocytes and engineered heart tissues reveal suppressed JAK2/STAT3 signaling in LMNA-related emery-dreifuss muscular dystrophy; Authors - Hangping Fan
mouse	WB	BMC Genomics; Integrated multi-omics analysis and functional validation uncovers RPL26 roles in regulating growth traits of Asian water buffaloes (Bubalus bubalis); Authors - Yangyang Shen

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Kazuaki (Verified Customer) (01-28-2025)

C2C12 cells differentiated for 5 days by using DMEM with 2%HS and 1%PS

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Mouse myoblast C2C12 cell line

Myogenin Antibody Western Blot validation (1:1000 dilution) in Mouse myoblast C2C12 cell line (Cat no:26762-1-AP)