Product Information
86192-3-PBS targets Myogenin in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25081 Product name: Recombinant human Myogenin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 138-224 aa of BC053899 Sequence: SLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN Predict reactive species |
| Full Name | myogenin (myogenic factor 4) |
| Calculated Molecular Weight | 25 kDa |
| Observed Molecular Weight | 25-30 kDa |
| GenBank Accession Number | BC053899 |
| Gene Symbol | Myogenin |
| Gene ID (NCBI) | 4656 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P15173 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
MYOG (encoded Myogenin protein) is a muscle-specific transcription factor that belongs to a family of basic helix-loop-helix transcription factors. It plays a role in muscle differentiation, cell cycle exit, and muscle atrophy(PMID: 30315160). Diseases associated with MYOG include Embryonal Rhabdomyosarcoma and Gallbladder Sarcoma.



