Product Information
66159-1-PBS targets NAPRT1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4265 Product name: Recombinant human NAPRT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-310 aa of BC032466 Sequence: MLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPLLRLCLQQGQLCEPLPSLAESRALAQLSLSRLSPEHRRLRSPAQYQVVLSERLQALVNSLCAGQSP Predict reactive species |
| Full Name | nicotinate phosphoribosyltransferase domain containing 1 |
| Calculated Molecular Weight | 514 aa, 55 kDa |
| Observed Molecular Weight | 51 kDa |
| GenBank Accession Number | BC032466 |
| Gene Symbol | NAPRT1 |
| Gene ID (NCBI) | 93100 |
| RRID | AB_2881555 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q6XQN6 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Nicotinic acid (NA) is a coenzyme in cellular redox reactions, and is an essential component of metabolic pathways in all living cells. NAPRT1 (Nicotinate phosphoribosyltransferase) is essential for increasing cellular NAD levels and, thus, to prevent oxidative stress of cells. NAPRT1 converts Nicotinic acid (NA; niacin) to NA mononucleotide (NaMN), which is then converted to NA adenine dinucleotide (NaAD), and finally to nicotinamide adenine dinucleotide (NAD).



















