NAT6/FUS2 Polyclonal antibody, PBS Only

• 

  WB analysis using 15476-1-AP (same clone as 15476-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15476-1-AP (NAT6/FUS2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15476-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 15476-1-AP (same clone as 15476-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using NAT6/FUS2 antibody (15476-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 15476-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

NAT6/FUS2 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 15476-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

15476-1-PBS targets NAT6/FUS2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7780

  Product name: Recombinant human NAT6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-308 aa of BC004483

  Sequence: MQELTLSPGPAKLTPTLDPTHRMELILSTSPAELTLDPACQPKLPLDSTCQPEMTFNPGPTELTLDPEHQPEETPAPSLAELTLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAPVVVGHARLSRVLNQPQSLLVETVVVARALRGRGFGRRLMEGLEVFARARGFRKLHLTTHDQVHFYTHLGYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGPKGPPLPPPPPLPECLTISPPVPSGPPSKSLLETQYQNVRGRPIFWMEKDI

• Full Name: N-acetyltransferase 6 (GCN5-related)
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC004483
• Gene Symbol: FUS2
• Gene ID (NCBI): 24142
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q93015
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The acetyltransferase NAT6 (also known as Fus2) is an enzyme that catalyzes the transfer of acetyl groups from acetyl-CoA to acrylamines and located mainly in the cytoplasm. NAT6 has two isoforms. The molecular weight of NAT6 was detected to be about 45kDa (PMID:32978259).