NAXE Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NAXE Polyclonal antibody (32022-1-AP)

• 

  WB analysis using 32022-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32022-1-AP (NAXE antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse cerebellum using 32022-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 32022-1-AP (NAXE antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 32022-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using NAXE antibody (32022-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

NAXE Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 32022-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

AIBP, AI-BP, APOA1BP, Apolipoprotein A-I-binding protein, EC:5.1.99.6

---

Tested Applications

• Positive WB detected in: HeLa cells, L02 cells, MCF-7 cells, NIH/3T3 cells, mouse liver tissue, rat kidney tissue
• Positive IHC detected in: mouse cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32022-1-AP targets NAXE in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35306

  Product name: Recombinant human APOA1BP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 166-288 aa of NM_144772.2

  Sequence: LGEMPAEPMTIDELYELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKGNAGGIQPDLLISLTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRLQ

• Full Name: apolipoprotein A-I binding protein
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: NM_144772.2
• Gene Symbol: APOA1BP
• Gene ID (NCBI): 128240
• RRID: AB_3670173
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8NCW5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NAD(P)H-hydrate epimerase (NAXE, also known as AIBP, YJEFN1, and APOA1BP) catalyzes the interconversion between the S- and R-forms of NAD(P)HX, and essentially supplies the substrate for the stereospecific enzyme NAD(P)HX dehydratase (NAXD) (PMID: 35866541). NAXE variants can cause neurometabolic disorder by disrupting the cellular NAD(P)HX repair system (PMID: 31745726; 27616477).