NCKAP5L Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 21392-1-AP (same clone as 21392-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 21392-1-AP (NCKAP5L antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21392-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 21392-1-AP (same clone as 21392-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin using 21392-1-AP (NCKAP5L antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21392-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 21392-1-AP (same clone as 21392-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin using 21392-1-AP (NCKAP5L antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21392-1-PBS in a different storage buffer formulation.

NCKAP5L Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 21392-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

21392-1-PBS targets NCKAP5L in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16050

  Product name: Recombinant human KIAA1602 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-61 aa of BC110599

  Sequence: MDQPAGGPGNPRPGEGDDGSMEPGTCQELLHRLRELEAENSALAQANENQRETYERCLDEV

• Full Name: KIAA1602
• Calculated Molecular Weight: 1334 aa, 139 kDa
• Observed Molecular Weight: 145-150 kDa
• GenBank Accession Number: BC110599
• Gene Symbol: NCKAP5L
• Gene ID (NCBI): 57701
• RRID: AB_10860259
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HCH0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NCKAP5L, also named as KIAA1602, has 4 isoforms. The target band is about 139-145 kDa for phosphorylation.