• Featured Product
  • KD/KO Validated

NCOA4 Polyclonal antibody

NCOA4 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 10968-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

IHC, IF/ICC, ELISA

70 kDa AR activator, 70 kDa AR-activator, Androgen receptor-associated protein of 70 kDa, ARA70, ELE1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10968-1-AP targets NCOA4 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1408

Product name: Recombinant human NCOA4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-400 aa of BC012736

Sequence: MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHLECLRSREVWLYEQVDLIYQLKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSVCLERLGSLTLKPEDSTVLLFEADTITLRQTITTFGSLKTIQIPEHLMAHASSANIGPFLEKRGCISMPEQKSASGIVAVPFSEWLLGSKPASGYQAPYIPSTDPQDWLTQKQTLENSQTSSRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSSFSIEMEKVGDQELPDQDEMDLSDWLVTPQESHKLRKPENGSRETSEKFKLLFQSYNVNDWLVKTDSCTNCQGNQPKGVEIENLGNLKCLNDHLEAKKPLSTPSMVTEDWLVQNHQDPCKV

Predict reactive species
Full Name nuclear receptor coactivator 4
Calculated Molecular Weight 70 kDa
GenBank Accession NumberBC012736
Gene Symbol NCOA4
Gene ID (NCBI) 8031
RRIDAB_3669123
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13772
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nuclear receptor coactivator 4 (NCOA4) also named androgen receptor (AR) coactivator ARA70, RFG and ELE1, is a putative co-activator that specifically enhances the activity of the androgen receptor. In human thyroid carcinomas, the Ret proto-oncogene fuses to ARA70 to form Ret/PTC3 by an intrachromosomal inversion of chromosome 10 in vivo. ARA70a can function as a ligand-enhanced co-activator of PPARg in adipocytes. However, PPARg-ARA70 transactivation can be squelched by AR, which suggests cross talk between PPARg- and AR-mediated response. ARA70a has no intrinsic transcription activation domain or histone acetyltransferase activity, but it interacts with histone acetyltransferase, p/CAF, CBP and p300/CBP-associated factors, and the basal transcription factor TFIIB. The interaction between ARA70 and AR occurs through the ligand-binding domain. The presence of ARA70 can enhance the androgenic activity of 17-b Estradiol (E2) and antiandrogens toward AR. ARA70 may be involved in prostate carcinogenesis and ovarian cancer and may serve as a key mediator of estrogen-androgen synergism.There are several isoforms of ZGPAT that are produced as a result of alternative splicing events. ARA70a is widely expressed, and its expression is highest in testis and adipose tissues, whereas ARA70b (The shorter variant, results from an internal 985-bp deletion.) is solely expressed in the testis.This antibody is a rabbit polyclonal antibody raised against the N-400aa of human NCOA4 protein.

Protocols

Product Specific Protocols
IF protocol for NCOA4 antibody 10968-1-APDownload protocol
IHC protocol for NCOA4 antibody 10968-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIHC

Biochim Biophys Acta Mol Basis Dis

IGF2BP1 exacerbates neuroinflammation and cerebral ischemia/reperfusion injury by regulating neuronal ferroptosis and microglial polarization

Authors - Youjun Li
human

Cancer Cell Int

Combination of astragalus polysaccharide with Diosbulbin B exerts an enhanced antitumor effect in BRAFmut papillary thyroid cancer with decreased liver toxicity

Authors - Shuai Xu
IHC

Adv Sci (Weinh)

BZW1 Drives Immune Evasion in Lung Adenocarcinoma via Ferroptosis Suppression

Authors - Linyao Zhao
humanIHC

Free Radic Biol Med

RTA-408 overcomes cisplatin-resistant lung cancer by inhibiting WWP1-mediated NCOA4 ubiquitination to induce ferritinophagy and ferroptosis

Authors - Xiaobian Wang
human

J Control Release

Metal phenolic networks-driven bufalin homodimeric prodrug nano-coassemblies for ferroptosis-augmented tumor therapy

Authors - Fei Wu
human,mouse

ACS Omega

Dopamine Alleviated Diabetic Retinal Neurodegeneration through Protecting Retinal Ganglion Cells from Ferroptosis via the Nrf2/HO‑1 Signaling Pathway

Authors - Suyun Rao
Loading...
||
New chat

Able

正在加载,请稍候...