NCX1 Polyclonal antibody

NCX1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28447-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, ELISA

Na(+)/Ca(2+)-exchange protein 1, NCX 1, NCX-1, SLC8A1, Solute carrier family 8 member 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse heart tissue, rat heart tissue, rat kidney tissue, mouse kidney tissue
Positive IHC detected inhuman kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:200-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 5 publications below

Product Information

28447-1-AP targets NCX1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag28952

Product name: Recombinant human SLC8A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-59 aa of NM_021097

Sequence: MYNMRRLSLSPTFSMGFHLLVTVSLLFSHVDHVIAETEMEGEGNETGECTGSYYCKKGV

Predict reactive species
Full Name solute carrier family 8 (sodium/calcium exchanger), member 1
Calculated Molecular Weight 109 kDa
Observed Molecular Weight70 kDa
GenBank Accession NumberNM_021097
Gene Symbol NCX1
Gene ID (NCBI) 6546
RRIDAB_2918167
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP32418
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC8A1, also known as NCX1, belongs to the SLC (Solute Carrier) family and the CaCA (Calcium/Cation Antiporter) superfamily. NCX1 is a bidirectional ion exchanger that can exchange sodium and calcium ions between the inside and outside of cells in a 1:3 ratio (1 Ca2+ ion and 3 Na+ ions). Under physiological conditions, NCX1 mainly transports Ca2+ from the cell interior to the exterior through the forward transport mode to maintain the low calcium level inside the cell. However, under certain special conditions, such as ischemia-reperfusion injury and stroke, the reverse transport mode of NCX1 is activated, leading to the influx of Ca2+ into the cell, which may cause cell damage (PMID: 21289289, 30686898).

Protocols

Product Specific Protocols
IHC protocol for NCX1 antibody 28447-1-APDownload protocol
WB protocol for NCX1 antibody 28447-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

J Neuroinflammation

Sexually dimorphic extracellular vesicle responses after chronic spinal cord injury are associated with neuroinflammation and neurodegeneration in the aged brain

Authors - Yun Li

J Mol Histol

Neuroprotection in neonatal Hypoxia-ischaemia: melatonin targets NCX1 to inhibit mitochondrial autophagy via the PINK1-Parkin pathway

Authors - Tongfei Cheng
pigWB

Physiol Rep

Environment-induced heat stress causes ventricular-dependent biochemical changes in the heart in female pigs

Authors - Melissa Roths

Signal Transduct Target Ther

Visinin-like protein 1 disrupts calcium homeostasis and promotes atrial fibrillation in human and rodent models

Authors - Ke Xiong
mouseWB

J Nutr Biochem

Ferulic acid ethyl ester modulates electrical remodeling in cardiomyocytes exposed to TNF-α-stimulated adipocyte secretome via Nrf2/HO-1 pathway

Authors - Hsiang-Yu Yang
mouseWB

Acta Pharmacol Sin

Porcupine inhibitor CGX1321 alleviates heart failure with preserved ejection fraction in mice by blocking WNT signaling

Authors - Hao Wu
Loading...
||
New chat

Able

正在加载,请稍候...