NCX1 Polyclonal antibody, PBS Only

NCX1 Polyclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 28447-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Na(+)/Ca(2+)-exchange protein 1, SLC8A1, Solute carrier family 8 member 1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

28447-1-PBS targets NCX1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag28952

Product name: Recombinant human SLC8A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-59 aa of NM_021097

Sequence: MYNMRRLSLSPTFSMGFHLLVTVSLLFSHVDHVIAETEMEGEGNETGECTGSYYCKKGV

Predict reactive species
Full Name solute carrier family 8 (sodium/calcium exchanger), member 1
Calculated Molecular Weight 109 kDa
Observed Molecular Weight70 kDa
GenBank Accession NumberNM_021097
Gene Symbol NCX1
Gene ID (NCBI) 6546
RRIDAB_2918167
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP32418
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SLC8A1, also known as NCX1, belongs to the SLC (Solute Carrier) family and the CaCA (Calcium/Cation Antiporter) superfamily. NCX1 is a bidirectional ion exchanger that can exchange sodium and calcium ions between the inside and outside of cells in a 1:3 ratio (1 Ca2+ ion and 3 Na+ ions). Under physiological conditions, NCX1 mainly transports Ca2+ from the cell interior to the exterior through the forward transport mode to maintain the low calcium level inside the cell. However, under certain special conditions, such as ischemia-reperfusion injury and stroke, the reverse transport mode of NCX1 is activated, leading to the influx of Ca2+ into the cell, which may cause cell damage (PMID: 21289289, 30686898).

Loading...
||
New chat Able
正在加载,请稍候...