Product Information
60534-2-PBS targets ND1 as part of a matched antibody pair:
MP50754-1: 60534-1-PBS capture and 60534-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag33365 Product name: Recombinant human ND1 protein Source: e coli.-derived, pcoldI-his-gst Tag: N-HIS;N-GST Domain: 23-67 aa of NC_012920 Sequence: TERKILGYMQLRKGPNVVGPYGLLQPFADAMKLFTKEPLKPATST Predict reactive species |
| Full Name | NADH dehydrogenase, subunit 1 (complex I) |
| Calculated Molecular Weight | 36KD |
| GenBank Accession Number | NC_012920 |
| Gene Symbol | ND1 |
| Gene ID (NCBI) | 4535 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G Magarose purification |
| UNIPROT ID | P03886 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



