NDRG4 Polyclonal antibody, PBS Only

• 

  WB analysis of human brain using 12184-1-AP (same clone as 12184-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 12184-1-AP (NDRG4 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12184-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 12184-1-AP (same clone as 12184-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 12184-1-AP (NDRG4 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12184-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human medulloblastoma using 12184-1-AP (same clone as 12184-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human medulloblastoma tissue slide using 12184-1-AP (NDRG4 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 12184-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human medulloblastoma using 12184-1-AP (same clone as 12184-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human medulloblastoma tissue slide using 12184-1-AP (NDRG4 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 12184-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 12184-1-AP (same clone as 12184-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 12184-1-AP (NDRG4 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 12184-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 12184-1-AP (same clone as 12184-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 12184-1-AP (NDRG4 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 12184-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 12184-1-AP (same clone as 12184-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12184-1-AP (NDRG4 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 12184-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 12184-1-AP (same clone as 12184-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12184-1-AP (NDRG4 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 12184-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 12184-1-AP (same clone as 12184-1-PBS)

  Immunofluorescent analysis of HepG2 cells, using NDRG4 antibody 12184-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 12184-1-PBS in a different storage buffer formulation.

NDRG4 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 12184-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

12184-1-PBS targets NDRG4 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3029

  Product name: Recombinant human NDRG4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-339 aa of BC011795

  Sequence: MPECWDGEHDIETPYGLLHVVIRGSPKGNRPAILTYHDVGLNHKLCFNTFFNFEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLVNIDPNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELVNNTELVQSYRQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNSKLDPTTTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYMPSASMTRLARSRTASLTSASSVDGSRPQACTHSESSEGLGQVNHTMEVSC

• Full Name: NDRG family member 4
• Calculated Molecular Weight: 339 aa, 37 kDa
• Observed Molecular Weight: 37 kDa, 38 kDa and 41 kDa
• GenBank Accession Number: BC011795
• Gene Symbol: NDRG4
• Gene ID (NCBI): 65009
• RRID: AB_2235852
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9ULP0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.