NDRG4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NDRG4 Polyclonal antibody (12184-1-AP)

NDRG4 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 12184-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

BDM1, Brain development-related molecule 1, NDRG family member 4, N-myc downstream-regulated gene 4 protein, Protein NDRG4

• 

  WB analysis of human brain using 12184-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12184-1-AP (NDRG4 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse kidney using 12184-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 12184-1-AP (NDRG4 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 12184-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12184-1-AP (NDRG4 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 12184-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12184-1-AP (NDRG4 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 12184-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 12184-1-AP (NDRG4 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 12184-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 12184-1-AP (NDRG4 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 12184-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 12184-1-AP (NDRG4 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 12184-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 12184-1-AP (NDRG4 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 12184-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12184-1-AP (NDRG4 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 12184-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12184-1-AP (NDRG4 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 12184-1-AP

  Immunofluorescent analysis of HepG2 cells, using NDRG4 antibody 12184-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NDRG4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human brain tissue, mouse kidney tissue
• Positive IHC detected in: mouse brain tissue, rat brain tissue, human gliomas tissue, human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12184-1-AP targets NDRG4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3029

  Product name: Recombinant human NDRG4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-339 aa of BC011795

  Sequence: MPECWDGEHDIETPYGLLHVVIRGSPKGNRPAILTYHDVGLNHKLCFNTFFNFEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLVNIDPNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELVNNTELVQSYRQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNSKLDPTTTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYMPSASMTRLARSRTASLTSASSVDGSRPQACTHSESSEGLGQVNHTMEVSC

• Full Name: NDRG family member 4
• Calculated Molecular Weight: 339 aa, 37 kDa
• Observed Molecular Weight: 37 kDa, 38 kDa and 41 kDa
• GenBank Accession Number: BC011795
• Gene Symbol: NDRG4
• Gene ID (NCBI): 65009
• RRID: AB_2235852
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9ULP0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Anti-NDRG4 (Catalog No. 12184-1-AP) has 4 total citations published in Cell Reports, BMB Reports, Journal of Neuro-Oncology, and DNA and Cell Biology. Associated research fields include mammalian spermatogenesis, pancreatic ductal adenocarcinoma (epigenetic regulation of mitochondrial function), glioma biology (PLK1-driven tumor growth), and bioinformatics analysis of the N-myc downstream-regulated gene family in glioma.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Cell Rep; The Mammalian Spermatogenesis Single-Cell Transcriptome, from Spermatogonial Stem Cells to Spermatids.; Authors - Brian P Hermann
human	WB	BMB Rep; Hypermethylation-mediated silencing of NDRG4 promotes pancreatic ductal adenocarcinoma by regulating mitochondrial function.; Authors - Hao-Hong Shi
		J Neurooncol; Targeting VAMP5 suppresses PLK1-driven growth of gliomas with high NDRG4 expression.; Authors - Yinghao Zhang
human	WB	DNA Cell Biol; The Role of N-myc Downstream-Regulated Gene Family in Glioma Based on Bioinformatics Analysis.; Authors - Ting Tang