NDUFA11 Polyclonal antibody

• 

  WB analysis using 17879-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 17879-1-AP (NDUFA11 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

NDUFA11 Polyclonal Antibody for WB, ELISA

Cat No. 17879-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

NADH-ubiquinone oxidoreductase subunit B14.7, Complex I-B14.7, Complex I B14.7, CI-B14.7, CI B14.7

---

Tested Applications

• Positive WB detected in: HeLa cells, MDA-MB-231 cells, RT-4 cells, U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

17879-1-AP targets NDUFA11 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11746

  Product name: Recombinant human NDUFA11 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-111 aa of BC069045

  Sequence: MAPKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTFTAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIG

• Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 11, 14.7kDa
• Calculated Molecular Weight: 141 aa, 15 kDa
• Observed Molecular Weight: 10-15 kDa
• GenBank Accession Number: BC069045
• Gene Symbol: NDUFA11
• Gene ID (NCBI): 126328
• RRID: AB_3669282
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86Y39
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mitochondrial complex I is assembled from 44 subunits into an L-shaped complex, with a hydrophobic arm embedded in the inner mitochondrial membrane and the other arm protruding into the mitochondrial matrix. NDUFA11 encodes a subunit of the membrane-bound mitochondrial complex I, and functions in assembly, stability, and regulation of the complex. Mutations in NDUFA11 are associated with severe mitochondrial complex I deficiency(PMID: 18306244).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Int J Mol Sci; RORα Suppresses Cancer-Associated Inflammation by Repressing Respiratory Complex I-Dependent ROS Generation.; Authors - Wei Mao