Tested Applications
Positive WB detected in | human brain tissue, HeLa cells |
Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 5 publications below |
Product Information
17257-1-AP targets NDUFA3 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag10912 Product name: Recombinant human NDUFA3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-65 aa of BC011021 Sequence: MAARVGAFLKNAWDKEPVLVVSFVVGGLEQSHDTTPRMLHDDPTLKRAHSMTNPTAASSRPHVSL Predict reactive species |
Full Name | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3, 9kDa |
Calculated Molecular Weight | 65aa,7 kDa; 84aa,9 kDa |
Observed Molecular Weight | 9 kDa |
GenBank Accession Number | BC011021 |
Gene Symbol | NDUFA3 |
Gene ID (NCBI) | 4696 |
RRID | AB_2150631 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O95167 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for NDUFA3 antibody 17257-1-AP | Download protocol |
IHC protocol for NDUFA3 antibody 17257-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
iScience Mutational burden of XPNPEP3 leads to defects in mitochondrial complex I and cilia in NPHPL1 | ||
J Biol Chem Complex I mutations synergize to worsen the phenotypic expression of Leber's hereditary optic neuropathy. | ||
Invest Ophthalmol Vis Sci Assocation Between Leber's Hereditary Optic Neuropathy and MT-ND1 3460G>A Mutation-Induced Alterations in Mitochondrial Function, Apoptosis, and Mitophagy. | ||
Sci Rep HDAC/H3K27ac-mediated transcription of NDUFA3 exerts protective effects on high glucose-treated human nucleus pulposus cells through improving mitochondrial function | ||
Cell Stem Cell Selective translation of nuclear mitochondrial respiratory proteins reprograms succinate metabolism in AML development and chemoresistance |