NDUFA9 Polyclonal antibody, PBS Only

• 

  WB analysis using 29621-1-AP (same clone as 29621-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29621-1-AP (NDUFA9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29621-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocirrhosis using 29621-1-AP (same clone as 29621-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 29621-1-AP (NDUFA9 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29621-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocirrhosis using 29621-1-AP (same clone as 29621-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 29621-1-AP (NDUFA9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29621-1-PBS in a different storage buffer formulation.

NDUFA9 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29621-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

29621-1-PBS targets NDUFA9 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31222

  Product name: Recombinant human NDUFA9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 108-227 aa of BC009311

  Sequence: WDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIP

• Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa
• Calculated Molecular Weight: 377 aa, 43 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC009311
• Gene Symbol: NDUFA9
• Gene ID (NCBI): 4704
• RRID: AB_2918331
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16795
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NDUFA9 (NADH: ubiquinone oxidoreductase subunit A9), also named as NDUFS2L, belongs to the complex I NDUFA9 subunit family. NDUFA9 gene encodes a subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (complex I). Instead of being implicated in the catalysis, NDUFA9 is required for proper assembly of the complex I (PMID: 34938809). The predicted molecular weight of NDUFA9 is 42 kDa. With modification, the MW of NDUFA9 will be migrated to 35 kDa.