NDUFC1 Polyclonal antibody, PBS Only

• 

  IHC staining of human heart using 23842-1-AP (same clone as 23842-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 23842-1-AP (NDUFC1 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 23842-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 23842-1-AP (same clone as 23842-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 23842-1-AP (NDUFC1 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 23842-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 23842-1-AP (same clone as 23842-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 23842-1-AP (NDUFC1 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 23842-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 23842-1-AP (same clone as 23842-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 23842-1-AP (NDUFC1 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 23842-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

NDUFC1 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 23842-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

NADH-ubiquinone oxidoreductase KFYI subunit, KFYI, Complex I-KFYI, Complex I KFYI, CI-KFYI

---

Product Information

23842-1-PBS targets NDUFC1 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20835

  Product name: Recombinant human NDUFC1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-76 aa of BC107682

  Sequence: MAPSALLRPLSRLLAPARLPSGPSVRSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRRNGLE

• Full Name: NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 1, 6kDa
• Calculated Molecular Weight: 76 aa, 9 kDa
• GenBank Accession Number: BC107682
• Gene Symbol: NDUFC1
• Gene ID (NCBI): 4717
• RRID: AB_2879336
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43677
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.