Tested Applications
Positive WB detected in | A549 cells, human kidney tissue, human liver tissue, Hela cells, HepG2 cells, mouse brain tissue, mouse heart tissue, rat brain tissue |
Positive IHC detected in | human kidney tissue, human hepatocirrhosis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 4 publications below |
Product Information
15573-1-AP targets NDUFC2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, pig |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag7919 Product name: Recombinant human NDUFC2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC007323 Sequence: MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR Predict reactive species |
Full Name | NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa |
Calculated Molecular Weight | 14 kDa |
Observed Molecular Weight | 14 kDa |
GenBank Accession Number | BC007323 |
Gene Symbol | NDUFC2 |
Gene ID (NCBI) | 4718 |
RRID | AB_10666733 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O95298 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for NDUFC2 antibody 15573-1-AP | Download protocol |
IHC protocol for NDUFC2 antibody 15573-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Commun Intellectual disability-associated factor Zbtb11 cooperates with NRF-2/GABP to control mitochondrial function. | ||
Sci Rep Proteomic analysis indicates that mitochondrial energy metabolism in skeletal muscle tissue is negatively correlated with feed efficiency in pigs. | ||
Cell Rep A membrane arm of mitochondrial complex I sufficient to promote respirasome formation. | ||
Environ Int Bisphenol S impairs mitochondrial function by targeting Myo19/oxidative phosphorylation pathway contributing to axonal and dendritic injury |