NDUFC2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NDUFC2 Polyclonal antibody (15573-1-AP)

NDUFC2 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 15573-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF-P, ELISA

Synonyms

B14.5b, CI B14.5b, CI-B14.5b, Complex I B14.5b, Complex I-B14.5b

• 

  WB analysis using 15573-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15573-1-AP (NDUFC2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 15573-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15573-1-AP (NDUFC2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human liver using 15573-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 15573-1-AP (NDUFC2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human kidney using 15573-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 15573-1-AP (NDUFC2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 15573-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 15573-1-AP (NDUFC2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 15573-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 15573-1-AP (NDUFC2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human hepatocirrhosis using 15573-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 15573-1-AP (NDUFC2 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human hepatocirrhosis using 15573-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 15573-1-AP (NDUFC2 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 15573-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 15573-1-AP (NDUFC2 antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 15573-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 15573-1-AP (NDUFC2 antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 15573-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using NDUFC2 antibody (15573-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NDUFC2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, human kidney tissue, human liver tissue, Hela cells, HepG2 cells, mouse brain tissue, mouse heart tissue, rat brain tissue
• Positive IHC detected in: human kidney tissue, human hepatocirrhosis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15573-1-AP targets NDUFC2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7919

  Product name: Recombinant human NDUFC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-119 aa of BC007323

  Sequence: MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR

• Full Name: NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC007323
• Gene Symbol: NDUFC2
• Gene ID (NCBI): 4718
• RRID: AB_10666733
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95298
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The NDUFC2 Polyclonal antibody (Cat# 15573-1-AP) has 6 citations across journals including Nature Communications, Environmental International, Cell Reports, Analytica Chimica Acta, Scientific Reports, and EMBO Reports. Research fields span mitochondrial function and oxidative phosphorylation, respiratory supercomplex assembly, chemoproteomic drug target identification, skeletal muscle energy metabolism, and mitotic regulation of tumor growth. All citations used Western blot applications in human, mouse, or pig samples.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Commun; Intellectual disability-associated factor Zbtb11 cooperates with NRF-2/GABP to control mitochondrial function.; Authors - Brooke C Wilson
mouse	WB	Environ Int; Bisphenol S impairs mitochondrial function by targeting Myo19/oxidative phosphorylation pathway contributing to axonal and dendritic injury; Authors - Xing Zhang
human	WB	Cell Rep; A membrane arm of mitochondrial complex I sufficient to promote respirasome formation.; Authors - Hezhi Fang
human	WB	Anal Chim Acta; A novel Halo Tag-based photo-crosslinking system for efficient drug target identification via chemoproteomic profiling.; Authors - Xiang Liu
pig	WB	Sci Rep; Proteomic analysis indicates that mitochondrial energy metabolism in skeletal muscle tissue is negatively correlated with feed efficiency in pigs.; Authors - Liangliang Fu
human	WB	EMBO Rep; Mitotic assembly of respiratory supercomplexes ensures accurate cell division and fuels tumor growth.; Authors - Ting Wang