Tested Applications
| Positive WB detected in | A549 cells, human kidney tissue, human liver tissue, Hela cells, HepG2 cells, mouse brain tissue, mouse heart tissue, rat brain tissue |
| Positive IHC detected in | human kidney tissue, human hepatocirrhosis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
Product Information
15573-1-AP targets NDUFC2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7919 Product name: Recombinant human NDUFC2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC007323 Sequence: MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR Predict reactive species |
| Full Name | NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa |
| Calculated Molecular Weight | 14 kDa |
| Observed Molecular Weight | 14 kDa |
| GenBank Accession Number | BC007323 |
| Gene Symbol | NDUFC2 |
| Gene ID (NCBI) | 4718 |
| RRID | AB_10666733 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95298 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for NDUFC2 antibody 15573-1-AP | Download protocol |
| WB protocol for NDUFC2 antibody 15573-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Intellectual disability-associated factor Zbtb11 cooperates with NRF-2/GABP to control mitochondrial function. | ||
Sci Rep Proteomic analysis indicates that mitochondrial energy metabolism in skeletal muscle tissue is negatively correlated with feed efficiency in pigs. | ||
Cell Rep A membrane arm of mitochondrial complex I sufficient to promote respirasome formation. | ||
Environ Int Bisphenol S impairs mitochondrial function by targeting Myo19/oxidative phosphorylation pathway contributing to axonal and dendritic injury |



















