Product Information
15224-1-PBS targets NDUFS5 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7441 Product name: Recombinant human NDUFS5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-106 aa of BC001884 Sequence: MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP Predict reactive species |
| Full Name | NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15kDa (NADH-coenzyme Q reductase) |
| Calculated Molecular Weight | 13 kDa |
| Observed Molecular Weight | 15 kDa |
| GenBank Accession Number | BC001884 |
| Gene Symbol | NDUFS5 |
| Gene ID (NCBI) | 4725 |
| RRID | AB_2149021 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43920 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
NDUFS5 gene is a member of the NADH dehydrogenase (ubiquinone) iron-sulfur protein family. The encoded protein is a subunit of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. The NDUFS5 mRNA is expressed ubiquitously in human tissues, with a relative higher expression in human heart, skeletal muscle, liver, kidney and fetal heart (PMID: 10070614). The NDUFS5 (15 kDa) subunit located at mitochondrion and contains two C-X9-C motifs that are predicted to form a helix-coil-helix structure, permitting the formation of intramolecular disulfide bonds (PMID: 21310150).







