Product Information
66053-2-PBS targets NDUFS5 as part of a matched antibody pair:
MP50607-1: 66053-2-PBS capture and 66053-1-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag7663 Product name: Recombinant human NDUFS5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-106 aa of BC001884 Sequence: MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP Predict reactive species |
Full Name | NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15kDa (NADH-coenzyme Q reductase) |
Calculated Molecular Weight | 13 kDa |
GenBank Accession Number | BC001884 |
Gene Symbol | NDUFS5 |
Gene ID (NCBI) | 4725 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A Magarose purification |
UNIPROT ID | O43920 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |