Product Information
CL488-66053 targets NDUFS5 in applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7663 Product name: Recombinant human NDUFS5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-106 aa of BC001884 Sequence: MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP Predict reactive species |
| Full Name | NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15kDa (NADH-coenzyme Q reductase) |
| Calculated Molecular Weight | 13 kDa |
| Observed Molecular Weight | 15 kDa |
| GenBank Accession Number | BC001884 |
| Gene Symbol | NDUFS5 |
| Gene ID (NCBI) | 4725 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O43920 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
NDUFS5 gene is a member of the NADH dehydrogenase (ubiquinone) iron-sulfur protein family. The encoded protein is a subunit of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. The NDUFS5 mRNA is expressed ubiquitously in human tissues, with a relative higher expression in human heart, skeletal muscle, liver, kidney and fetal heart (PMID: 10070614). The NDUFS5 (15 kDa) subunit located at mitochondrion and contains two C-X9-C motifs that are predicted to form a helix-coil-helix structure, permitting the formation of intramolecular disulfide bonds (PMID: 21310150). Proteinteach’s NDUFS5 antibody 66053-1-Ig is capable of detecting the 15 kDa protein in Western blotting.
