Use Able AI chat for product recommendations

NDUFS5 Monoclonal antibody

NDUFS5 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66053-1-Ig
Clone No. 2C2A5
Review Product
Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

2C2A5, CI 15 kDa, CI-15 kDa, Complex I 15 kDa, Complex I-15 kDa

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for NDUFS5 in ?

Tested Applications

Positive WB detected inHepG2 cells, L02 cells, HEK-293 cells, fetal human brain tissue
Positive IHC detected inhuman ovary cancer tissue, rat ovary tissue, mouse cerebellum tissue, mouse kidney tissue, rat cerebellum tissue, rat kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66053-1-Ig targets NDUFS5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7663

Product name: Recombinant human NDUFS5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-106 aa of BC001884

Sequence: MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP

Predict reactive species
Full Name NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15kDa (NADH-coenzyme Q reductase)
Calculated Molecular Weight 13 kDa
Observed Molecular Weight 15 kDa
GenBank Accession NumberBC001884
Gene Symbol NDUFS5
Gene ID (NCBI) 4725
RRIDAB_11043342
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO43920
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NDUFS5 gene is a member of the NADH dehydrogenase (ubiquinone) iron-sulfur protein family. The encoded protein is a subunit of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. The NDUFS5 mRNA is expressed ubiquitously in human tissues, with a relative higher expression in human heart, skeletal muscle, liver, kidney and fetal heart (PMID: 10070614). The NDUFS5 (15 kDa) subunit located at mitochondrion and contains two C-X9-C motifs that are predicted to form a helix-coil-helix structure, permitting the formation of intramolecular disulfide bonds (PMID: 21310150). Proteinteach's NDUFS5 antibody 66053-1-Ig is capable of detecting the 15 kDa protein in Western blotting.

Protocols

Product Specific Protocols
IHC protocol for NDUFS5 antibody 66053-1-IgDownload protocol
WB protocol for NDUFS5 antibody 66053-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able™

正在加载,请稍候...