NDUFS6 Monoclonal antibody

• 

  WB analysis of rabbit heart using 68329-1-Ig

  rabbit heart tissue were subjected to SDS PAGE followed by western blot with 68329-1-Ig (NDUFS6 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 68329-1-Ig

  HepG2 cells were subjected to SDS PAGE followed by western blot with 68329-1-Ig (NDUFS6 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human prostate cancer using 68329-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 68329-1-Ig (NDUFS6 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 68329-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 68329-1-Ig (NDUFS6 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 68329-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using NDUFS6 antibody (68329-1-Ig, Clone: 2F4H3 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-phalloidin (red).

NDUFS6 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 68329-1-Ig

Clone No.2F4H3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, rabbit, chicken

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

2F4H3, CI 13kD A, CI-13kD-A, Complex I 13kD A, Complex I-13kD-A

---

Tested Applications

• Positive WB detected in: rabbit heart tissue, HepG2 cells, rat heart tissue, mouse heart tissue, chicken heart tissue
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68329-1-Ig targets NDUFS6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, rabbit, chicken samples.

• Tested Reactivity: human, mouse, rat, rabbit, chicken
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6286

  Product name: Recombinant human NDUFS6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-124 aa of BC046155

  Sequence: MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH

• Full Name: NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Q reductase)
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 13-15 kDa
• GenBank Accession Number: BC046155
• Gene Symbol: NDUFS6
• Gene ID (NCBI): 4726
• RRID: AB_2935401
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O75380
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NDUFS6(NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial) is also named as CI-13kD-A, NADH-ubiquinone oxidoreductase 13 kDa-A subunit and belongs to the complex I NDUFS6 subunit family.It is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis.