Tested Applications
Positive WB detected in | HepG2 cells, human heart tissue, human liver tissue |
Positive IHC detected in | human placenta tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 5 publications below |
Product Information
13430-1-AP targets NDUFV3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag4234 Product name: Recombinant human NDUFV3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-108 aa of BC033766 Sequence: MAAPCLLRQGRAGALKTMLQEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKKPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPRH Predict reactive species |
Full Name | NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa |
Calculated Molecular Weight | 108 aa, 12 kDa |
Observed Molecular Weight | 10 kDa |
GenBank Accession Number | BC033766 |
Gene Symbol | NDUFV3 |
Gene ID (NCBI) | 4731 |
RRID | AB_2282462 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P56181 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NDUFV3(NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial) is also named as CI-9kD,Renal carcinoma antigen NY-REN-4 and belongs to the complex I NDUFV3 subunit family.It is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for NDUFV3 antibody 13430-1-AP | Download protocol |
IHC protocol for NDUFV3 antibody 13430-1-AP | Download protocol |
IF protocol for NDUFV3 antibody 13430-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Proteome Res Quantitative proteomics reveals oxygen-dependent changes in neuronal mitochondria affecting function and sensitivity to rotenone. | ||
J Pharmacol Exp Ther Metabolic Mechanisms and a Rational Combinational Application of Carboxyamidotriazole in Fighting Pancreatic Cancer Progression after Chemotherapy. | ||
F1000Res Androgen-dependent alternative mRNA isoform expression in prostate cancer cells. | ||