NECAB1 Polyclonal antibody

• 

  IHC staining of mouse brain using 16477-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16477-1-AP (NECAB1 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 16477-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16477-1-AP (NECAB1 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 16477-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using NECAB1 antibody (16477-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

NECAB1 Polyclonal Antibody for IHC, IF-P, ELISA

Cat No. 16477-1-AP

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF-P, ELISA

Synonyms

STIP 1, N-terminal EF-hand calcium-binding protein 1, Neuronal calcium-binding protein 1, EF-hand calcium-binding protein 1, EFCBP1

---

Tested Applications

• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

16477-1-AP targets NECAB1 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9591

  Product name: Recombinant human NECAB1 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 252-351 aa of BC016340

  Sequence: MLVQRQMSVMEEDLEEFQLALKHYVESASSQSGCLRISIQKLSNESRYMIYEFWENSSVWNSHLQTNYSKTFQRSNVDFLETPELTSTMLVPASWWILNN

• Full Name: N-terminal EF-hand calcium binding protein 1
• Calculated Molecular Weight: 351 aa, 40 kDa
• GenBank Accession Number: BC016340
• Gene Symbol: NECAB1
• Gene ID (NCBI): 64168
• RRID: AB_3085492
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N987
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NECAB1, also named as EFCBP1, is a brain-specifically expressed gene with highest abundance in temporal lobe, encodes a protein containing EF-hand and antibiotic biosynthesis monooxygenase domains Short Communication.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Nat Commun; Intra-somatosensory cortical circuits mediating pain-induced analgesia; Authors - Ji-Ye Huang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Reyes (Verified Customer) (08-08-2024)

NECAB2 (in green) marked a layer of my human brain cortex neurons (red).

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:100
• Cell Tissue Type: Human Brain Cortex

NECAB1 Antibody Immunofluorescence validation (1:100 dilution) in Human Brain Cortex (Cat no:16477-1-AP)