NEDD1 Polyclonal antibody, PBS Only

• 

  WB analysis using 13993-1-AP (same clone as 13993-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13993-1-AP (NEDD1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13993-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 13993-1-AP (same clone as 13993-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 13993-1-AP (NEDD1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13993-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SH-SY5Y using 13993-1-AP (same clone as 13993-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 13993-1-AP (NEDD1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13993-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 13993-1-AP (same clone as 13993-1-PBS)

  IP result of anti-NEDD1 (IP:13993-1-AP, 3ug; Detection:13993-1-AP 1:800) with HeLa cells lysate 2150ug. This data was developed using the same antibody clone with 13993-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 13993-1-AP (same clone as 13993-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 13993-1-AP (NEDD1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13993-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 13993-1-AP (same clone as 13993-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 13993-1-AP (NEDD1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13993-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 13993-1-AP (same clone as 13993-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 13993-1-AP (NEDD1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13993-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 13993-1-AP (same clone as 13993-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 13993-1-AP (NEDD1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13993-1-PBS in a different storage buffer formulation.

NEDD1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 13993-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

13993-1-PBS targets NEDD1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5077

  Product name: Recombinant human NEDD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-332 aa of BC027605

  Sequence: MQENLRFASSGDDIKIWDASSMTLVDKFNPHTSPHGISSICWSSNNNFLVTASSSGDKIVVSSCKCKPVPLLELAEGQKQTCVNLNSTSMYLVSGGLNNTVNIWDLKSKRVHRSLKDHKDQVTCVTYNWNDCYIASGSLSGEIILHSVTTNLSSTPFGHGSNQSVRHLKYSLFKKSLLGSVSDNGIVTLWDVNSQSPYHNFDSVHKAPASGICFSPVNELLFVTIGLDKRIILYDTSSKKLVKTLVADTPLTAVDFMPDGATLAIGSSRGKIYQYDLRMLKSPVKTISAHKTSVQCIAFQYSTVLTKSSLNKGCSNKPTTVNKRSVNVNAAS

• Full Name: neural precursor cell expressed, developmentally down-regulated 1
• Calculated Molecular Weight: 72 kDa
• Observed Molecular Weight: 75 kDa, 62 kDa
• GenBank Accession Number: BC027605
• Gene Symbol: NEDD1
• Gene ID (NCBI): 121441
• RRID: AB_2149202
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NHV4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NEDD1 is required for mitosis progression. NEDD1 promotes the nucleation of microtubules from the spindle. This antibody works well in WB, IHC, IP and IF application.