NEDD1 Polyclonal antibody

• 

  WB analysis using 13993-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13993-1-AP (NEDD1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 13993-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 13993-1-AP (NEDD1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 13993-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 13993-1-AP (NEDD1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 13993-1-AP

  IP result of anti-NEDD1 (IP:13993-1-AP, 3ug; Detection:13993-1-AP 1:800) with HeLa cells lysate 2150ug.

• 

  IHC staining of human liver using 13993-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 13993-1-AP (NEDD1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 13993-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 13993-1-AP (NEDD1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 13993-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 13993-1-AP (NEDD1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 13993-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 13993-1-AP (NEDD1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

NEDD1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 13993-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

GCP WD, NEDD 1, NEDD1, Protein NEDD1, TUBGCP7

---

Tested Applications

• Positive WB detected in: HEK-293 cells, human brain tissue, SH-SY5Y cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human liver tissue, human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

13993-1-AP targets NEDD1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5077

  Product name: Recombinant human NEDD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-332 aa of BC027605

  Sequence: MQENLRFASSGDDIKIWDASSMTLVDKFNPHTSPHGISSICWSSNNNFLVTASSSGDKIVVSSCKCKPVPLLELAEGQKQTCVNLNSTSMYLVSGGLNNTVNIWDLKSKRVHRSLKDHKDQVTCVTYNWNDCYIASGSLSGEIILHSVTTNLSSTPFGHGSNQSVRHLKYSLFKKSLLGSVSDNGIVTLWDVNSQSPYHNFDSVHKAPASGICFSPVNELLFVTIGLDKRIILYDTSSKKLVKTLVADTPLTAVDFMPDGATLAIGSSRGKIYQYDLRMLKSPVKTISAHKTSVQCIAFQYSTVLTKSSLNKGCSNKPTTVNKRSVNVNAAS

• Full Name: neural precursor cell expressed, developmentally down-regulated 1
• Calculated Molecular Weight: 72 kDa
• Observed Molecular Weight: 75 kDa, 62 kDa
• GenBank Accession Number: BC027605
• Gene Symbol: NEDD1
• Gene ID (NCBI): 121441
• RRID: AB_2149202
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NHV4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NEDD1 is required for mitosis progression. NEDD1 promotes the nucleation of microtubules from the spindle. This antibody works well in WB, IHC, IP and IF application.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Science; The mechanism of acentrosomal spindle assembly in human oocytes; Authors - Tianyu Wu
human	WB,IHC	J Cancer; NEDD1 Promotes the Development of Lung Adenocarcinoma and Can be Used as a Prognostic Marker; Authors - Zhen Yang ; KD Validated