• Featured Product
  • KD/KO Validated

NEDD9 Recombinant monoclonal antibody, PBS Only (Capture)

NEDD9 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 83362-2-PBS
Clone No.240310F8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

240310F8, CASL, CAS-L, CRK-associated substrate-related protein, Enhancer of filamentation 1 p55

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83362-2-PBS targets NEDD9 as part of a matched antibody pair:

MP00378-2: 83362-2-PBS capture and 83362-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34170

Product name: Recombinant human NEDD9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 227-458 aa of BC040207

Sequence: PSACRDEAGLREKDYDFPPPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLHNPPDAKGSRDLVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTAIERLQRLQQALEMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELF

Predict reactive species
Full Name neural precursor cell expressed, developmentally down-regulated 9
Calculated Molecular Weight 834 aa, 93 kDa
Observed Molecular Weight 105 kDa, 115 kDa
GenBank Accession NumberBC040207
Gene Symbol NEDD9
Gene ID (NCBI) 4739
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14511
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

NEDD9, also known as CASL, HEF1, contains an N-terminal Src homology (SH) 3 domain and an adjacent domain composed of multiple SH2-binding motifs(PMID: 8668148). Cell cycle-regulated processing produces four isoforms: p115, p105, p65, and p55. Isoform p115 arises from p105 phosphorylation and appears later in the cell cycle. Isoform p55 arises from p105 as a result of cleavage at a caspase cleavage-related site and it appears specifically at mitosis. p105 and p115 are predominantly cytoplasmic and associated with focal adhesions, whereas p55associates with the mitotic spindle(PMID: 9584194).

Loading...
||
New chat

Able

正在加载,请稍候...