CoraLite® Plus 488-conjugated NEDD9 Recombinant monoclonal antibody

• 

  IF Staining of A549 using CL488-83362-2

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using CoraLite® Plus 488 NEDD9 antibody (CL488-83362-2, Clone: 240310F8 ) at dilution of 1:200.

NEDD9 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-83362-2

Clone No.240310F8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

240310F8, CASL, CAS-L, CRK-associated substrate-related protein, Enhancer of filamentation 1 p55

---

Tested Applications

• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83362-2 targets NEDD9 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34170

  Product name: Recombinant human NEDD9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 227-458 aa of BC040207

  Sequence: PSACRDEAGLREKDYDFPPPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLHNPPDAKGSRDLVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTAIERLQRLQQALEMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELF

• Full Name: neural precursor cell expressed, developmentally down-regulated 9
• Calculated Molecular Weight: 834 aa, 93 kDa
• Observed Molecular Weight: 105 kDa, 115 kDa
• GenBank Accession Number: BC040207
• Gene Symbol: NEDD9
• Gene ID (NCBI): 4739
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14511
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

NEDD9, also known as CASL, HEF1, contains an N-terminal Src homology (SH) 3 domain and an adjacent domain composed of multiple SH2-binding motifs(PMID: 8668148). Cell cycle-regulated processing produces four isoforms: p115, p105, p65, and p55. Isoform p115 arises from p105 phosphorylation and appears later in the cell cycle. Isoform p55 arises from p105 as a result of cleavage at a caspase cleavage-related site and it appears specifically at mitosis. p105 and p115 are predominantly cytoplasmic and associated with focal adhesions, whereas p55associates with the mitotic spindle(PMID: 9584194).