• KD/KO Validated

CoraLite® Plus 488-conjugated NEDD9 Recombinant monoclonal antibody

NEDD9 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-83362-2
Clone No.240310F8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

240310F8, CASL, CAS-L, CRK-associated substrate-related protein, Enhancer of filamentation 1 p55

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA549 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83362-2 targets NEDD9 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34170

Product name: Recombinant human NEDD9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 227-458 aa of BC040207

Sequence: PSACRDEAGLREKDYDFPPPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLHNPPDAKGSRDLVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTAIERLQRLQQALEMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELF

Predict reactive species
Full Name neural precursor cell expressed, developmentally down-regulated 9
Calculated Molecular Weight 834 aa, 93 kDa
Observed Molecular Weight 105 kDa, 115 kDa
GenBank Accession NumberBC040207
Gene Symbol NEDD9
Gene ID (NCBI) 4739
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14511
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

NEDD9, also known as CASL, HEF1, contains an N-terminal Src homology (SH) 3 domain and an adjacent domain composed of multiple SH2-binding motifs(PMID: 8668148). Cell cycle-regulated processing produces four isoforms: p115, p105, p65, and p55. Isoform p115 arises from p105 phosphorylation and appears later in the cell cycle. Isoform p55 arises from p105 as a result of cleavage at a caspase cleavage-related site and it appears specifically at mitosis. p105 and p115 are predominantly cytoplasmic and associated with focal adhesions, whereas p55associates with the mitotic spindle(PMID: 9584194).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 NEDD9 antibody CL488-83362-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...