Tested Applications
Positive WB detected in | C6 cells, HeLa cells, Jurkat cells, NIH/3T3 cells |
Positive IHC detected in | mouse heart tissue, human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:12000 |
Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
31422-1-AP targets NEK7 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag33629 Product name: Recombinant human NEK7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-36 aa of NM_133494 Sequence: MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRI Predict reactive species |
Full Name | NIMA (never in mitosis gene a)-related kinase 7 |
Calculated Molecular Weight | 35 |
Observed Molecular Weight | 32-35 kDa |
GenBank Accession Number | NM_133494 |
Gene Symbol | NEK7 |
Gene ID (NCBI) | 140609 |
RRID | AB_3669975 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity Purification |
UNIPROT ID | Q8TDX7 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Mammalian NIMA-related kinases (NEKs) represent a family of serine/threonine kinases, named NEK1-NEK11, which are implicated in the control of several aspects of mitosis and are involved in non-mitotic functions (PMID: 33364979). NIMA-related kinase 7 (NEK7) is the smallest NIMA-related kinase (NEK) in mammals. NEK7 is identified as a highly conserved serine or threonine kinase, which is not only crucial for mitosis entry, cell cycle progression, cell division, and mitotic process, but also expressed in brain, heart, lung, liver, spleen, and other issues (PMID: 31787755).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for NEK7 antibody 31422-1-AP | Download protocol |
IHC protocol for NEK7 antibody 31422-1-AP | Download protocol |
IF protocol for NEK7 antibody 31422-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |