CoraLite® Plus 488-conjugated NET1 Polyclonal antibody

• 

  IF Staining of mouse brain using CL488-28180

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using CoraLite® Plus 488 NET1 antibody (CL488-28180) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using CL488-28180

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using CoraLite® Plus 488 NET1 antibody (CL488-28180) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of Jurkat using CL488-28180

  1x10^6 Jurkat cells were intracellularly stained with 0.8 ug CoraLite® Plus 488 Anti-Human NET1 (CL488-28180)(red), or 0.8 ug CoraLite® Plus 488-conjugated Rabbit IgG control Rabbit PolyAb (CL488-30000) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• Featured Product
• KD/KO Validated

NET1 Polyclonal Antibody for IF-P, FC (Intra)

Cat No. CL488-28180

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse

Applications

IF-P, FC (Intra)

Synonyms

ARHGEF8, NET1, NET1A, Proto oncogene p65 Net1

---

Tested Applications

• Positive IF-P detected in: mouse brain tissue
• Positive FC (Intra) detected in: Jurkat cells
• Positive FC detected in: Jurkat cells

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
• Flow Cytometry (FC): FC : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-28180 targets NET1 in IF-P, FC (Intra) applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28142

  Product name: Recombinant human NET1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 442-542 aa of BC010285

  Sequence: IRAAIAPFQSAGSPPELQGLPELHEECEGNHPSARKLTAQRRASTVSSVTQVEVDENAYRCGSGMQMAEDSKSLKTHQTQPGIRRARDKALSGGKRKETLV

• Full Name: neuroepithelial cell transforming 1
• Calculated Molecular Weight: 596 aa, 68 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC010285
• Gene Symbol: NET1
• Gene ID (NCBI): 10276
• RRID: AB_3672824
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z628
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.