Tested Applications
Positive IF-P detected in | mouse brain tissue |
Positive FC (Intra) detected in | Jurkat cells |
Positive FC detected in | Jurkat cells |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
Flow Cytometry (FC) | FC : 0.80 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL488-28180 targets NET1 in IF-P, FC (Intra) applications and shows reactivity with Human, Mouse samples.
Tested Reactivity | Human, Mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag28142 Product name: Recombinant human NET1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 442-542 aa of BC010285 Sequence: IRAAIAPFQSAGSPPELQGLPELHEECEGNHPSARKLTAQRRASTVSSVTQVEVDENAYRCGSGMQMAEDSKSLKTHQTQPGIRRARDKALSGGKRKETLV Predict reactive species |
Full Name | neuroepithelial cell transforming 1 |
Calculated Molecular Weight | 596 aa, 68 kDa |
Observed Molecular Weight | 68 kDa |
GenBank Accession Number | BC010285 |
Gene Symbol | NET1 |
Gene ID (NCBI) | 10276 |
RRID | AB_3672824 |
Conjugate | CoraLite® Plus 488 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q7Z628 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL Plus 488 NET1 antibody CL488-28180 | Download protocol |
FC protocol for CL Plus 488 NET1 antibody CL488-28180 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |