Tested Applications
| Positive WB detected in | Y79 cells, mouse brain tissue, Jurkat cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 4 publications below |
| WB | See 6 publications below |
| IHC | See 1 publications below |
| IF | See 4 publications below |
Product Information
28180-1-AP targets NET1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28142 Product name: Recombinant human NET1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 442-542 aa of BC010285 Sequence: IRAAIAPFQSAGSPPELQGLPELHEECEGNHPSARKLTAQRRASTVSSVTQVEVDENAYRCGSGMQMAEDSKSLKTHQTQPGIRRARDKALSGGKRKETLV Predict reactive species |
| Full Name | neuroepithelial cell transforming 1 |
| Calculated Molecular Weight | 596 aa, 68 kDa |
| Observed Molecular Weight | 68 kDa |
| GenBank Accession Number | BC010285 |
| Gene Symbol | NET1 |
| Gene ID (NCBI) | 10276 |
| RRID | AB_2881082 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q7Z628 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for NET1 antibody 28180-1-AP | Download protocol |
| WB protocol for NET1 antibody 28180-1-AP | Download protocol |
| IF protocol for NET1 antibody 28180-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Gastric Cancer LncRNA CTC-497E21.4 promotes the progression of gastric cancer via modulating miR-22/NET1 axis through RhoA signaling pathway. | ||
Reprod Biol Endocrinol NET1 is a critical regulator of spindle assembly and actin dynamics in mouse oocytes
| ||
Front Cardiovasc Med Macrophages-Related Genes Biomarkers in the Deterioration of Atherosclerosis. | ||
Sci Rep Multiomics analysis reveals the involvement of NET1 in tumour immune regulation and malignant progression | ||
iScience Neuroepithelial cell-transforming 1 promotes cardiac fibrosis via the Wnt/β-catenin signaling pathway
| ||
Gastroenterology Cell-in-Cell-Mediated Entosis Reveals A Progressive Mechanism in Pancreatic Cancer
|











