NET1 Polyclonal antibody

• 

  WB analysis using 28180-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 28180-1-AP (NET1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 28180-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 28180-1-AP (NET1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 28180-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 28180-1-AP (NET1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 28180-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28180-1-AP (NET1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 28180-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28180-1-AP (NET1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 28180-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using NET1 antibody (28180-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

NET1 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 28180-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, ELISA

Synonyms

Proto-oncogene p65 Net1, Proto oncogene p65 Net1, Neuroepithelial cell-transforming gene 1 protein, NET1A, ARHGEF8

---

Tested Applications

• Positive WB detected in: Y79 cells, mouse brain tissue, Jurkat cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 4 publications below
• WB: See 6 publications below
• IHC: See 1 publications below
• IF: See 4 publications below

Product Information

28180-1-AP targets NET1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28142

  Product name: Recombinant human NET1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 442-542 aa of BC010285

  Sequence: IRAAIAPFQSAGSPPELQGLPELHEECEGNHPSARKLTAQRRASTVSSVTQVEVDENAYRCGSGMQMAEDSKSLKTHQTQPGIRRARDKALSGGKRKETLV

• Full Name: neuroepithelial cell transforming 1
• Calculated Molecular Weight: 596 aa, 68 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC010285
• Gene Symbol: NET1
• Gene ID (NCBI): 10276
• RRID: AB_2881082
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z628
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Gastric Cancer; LncRNA CTC-497E21.4 promotes the progression of gastric cancer via modulating miR-22/NET1 axis through RhoA signaling pathway.; Authors - Wei Zong
mouse	WB,IF	Reprod Biol Endocrinol; NET1 is a critical regulator of spindle assembly and actin dynamics in mouse oocytes; Authors - Shiwei Wang ; KD Validated
mouse		Front Cardiovasc Med; Macrophages-Related Genes Biomarkers in the Deterioration of Atherosclerosis.; Authors - Yue Zheng
human,mouse	WB,IHC,IF	Gastroenterology; Cell-in-Cell-Mediated Entosis Reveals A Progressive Mechanism in Pancreatic Cancer; Authors - Jianlu Song ; KD Validated
mouse	WB,IF	iScience; Neuroepithelial cell-transforming 1 promotes cardiac fibrosis via the Wnt/β-catenin signaling pathway; Authors - Tianyu Li ; KD Validated
mouse	WB,IF	Theriogenology; Reduced NET1 adversely affects early embryonic development in mice; Authors - Shiwei Wang ; KD Validated